We found the following complaints for CHEVROLET MALIBU (2012)
Read complaints for CHEVROLET MALIBU (2012)
Antitheft system is causing my car not to start. I have contact gm they are not willing to help. I research online line where chevrolet knows about the issue but want customer to fix the problem themselves. I was stranded for 4 hours in the houston heat with my kids. The car will stop in traffic as well
Takata airbag did not deploy while in front end collision. I was driving straight on a main street when i was hit in the front by 2 cars. The driver side airbag did not deploy.
Right front seat indicator light turns off and on while sat on
The contact owns a 2012 chevrolet malibu. The contact stated that while driving approximately 65 mph, another vehicle crashed into the passenger's side of the contact's vehicle and the air bags failed to deploy. A police report was filed. The contact sustained whiplash which required medical attention. The vehicle was destroyed. The manufacturer was not notified of the failure. The approximate failure mileage was 68,000.
Purchased car in sac 7/29/14.didn't use for 5 days-out of town. Upon return, car struggled to start. Took to our mechanic- battery low. Hertz sales replaced at no cost. Daughter/driver the only person in the car. On(8/5),son, 5'9",125lbs. In front passenger seat-the airbag sensor light did not go on. Car on when he got in. Turned off car, got in,restarted but still didn't register him. Went from off-on-off. Attempted several times but airbag light didn't go on. Son rode in back.when dropped off car to have battery replaced, told salesman re:airbag light.we had experienced same airbag issue in another malibu when shopping @dealership in santa clara& therefore didn't purchase that car.picked up car after battery replaced.salesman tested sensor.detected his presence when seated after about 15sec.tested by leaning/pushing on seat-sometimes light went on&sometimes not (presumably not enough weight to trigger it).was told if had this problem again-bring back&would be sent to the dealer to be fixed.thought perhaps airbag sensor issue related to a low battery.no issue first few days when son sat in front.but have sensor problem again.once more,son was sitting in the passenger seat&the airbag sensor did not detect him.sat in back again bc didn't want to risk air bag not deploying if accident.did internet search-learned recall issued on 5-14-14 for other issues.numerous complaints about this issue documented on this nhtsa website.found article that said some 2012 malibus were recalled for an air bag sensor issue (recall #12v224000)but other searches,say for 2013 malibus?our teens use this car for school.safety is top priority.the risk for great harm is unnerving.have filed report with gm/chevy&got ref#.said dealer will fix using that reference number.i have written to the hertz sales dealer where we purchased the car&am awaiting a response from them as to what action we should take next.
We have talked to out two different chevy dealers about this and even went through arbitration over our airbags. Nothing has ever been found to be wrong. The service air bag light has come on again. I was driving approximately 30 mph and the service air bag light on the display come on momentarily (about 60 seconds) and went off. It came on for about 15 seconds and started flashing, then it stayed solid again. Now, every time i start the car, it is on.
The contact owns a 2012 chevrolet malibu. Upon starting the vehicle, the service air bag warning indicator remained illuminated. The vehicle was taken to a dealer where it was diagnosed that the steering wheel sensor needed to be replaced. The vehicle was repaired. The manufacturer was notified of the failure. The approximate failure mileage was 32,000. The vin was unavailable.updated 08/03/16*ljaccording to the repair invoice, the driver side air bag coil failed. Updated 08/10/16.
Takata recall. My vehicle have had this system pop on a few times. As of september the light has been on abd and has not gone off. It also affect the esc system.
Airbag readiness error b0014indicator comes on when vehicle is started. It beeps 3 times and the light remains illuminated even after putting the vehicle in motion. Previous recall repair on seatbelt tensioners and airbag system. Records available in chevy maintenance history.
The service air bag light constantly comes on and off, and to be honest it makes me a little worried. Especially with all the recalls going on. It will come on and stay on for 5-30 min and go off and so on. We have other problems with this car as well and still have. Very unhappy with it. Will be happy for a new vehicle.
My service traction control light was coming on ever since i bought my car and i took it to koons for service and i was told one wheel was moving faster then another not to worry about it then on 06/18/2014 iwas hit by a chevy silverado that ran a light and i was doing 45 miles an hour i had my granddaughter in her safety seat in the back none of my air bags worked nor did my seat belts my grand daughter hit the back of the seats.now my car is flashing the codes again now that its fixed and shuts down while driving .its part of the gm recall for the upper wire harness but they are saying it isn't and they are not standing buy the warranty this defect almost killed us and still is almost killing us by shutting down while driving service traction control lights coming on plus air bag lights saying air bags are shutting down .so that means the air bags if we needed them would not help us again if needed.we were very badly hurt the last time and i need gm to step up and reimburse us for our injuries and for making us still ride in an unsafe car that they now is on the recall list but they keep saying its not.my car is still in service and service is saying it is part of the recall bit gm will not take responsibility. ..
In my 2012 chevrolet malibu's when my wife sits in the passenger seat the airbag system does recognize she is there.you can watch as the system goes through it's start up process with the airbag on/off light cycling from off to on and back to off. We were told that it is how my wife sits in the seat but i have video of her sitting with her feet on the dash (which is not an "approved" seating position) and the airbag system shows the seat is occupied and the passenger airbag is armed. This problem has not occurred in any other vehicle we have driven. My wife weighs 145 so it is not that she is too light for the sensor. The other day i was at a gm dealer and found a used 2012 malibu with the same trim package as mine and we tested it to see if that car would do the same thing as mine. It did on the first time we turned the key, i have video of that failure. We have been unable to reproduce this problem except in both 2012 malibu's. On my car the passenger presence sensor has been replaced 3 times and a seat from another malibu was installed and the airbag system still fails to operate correctly. The dealership told me the gm engineer said he did not know how to solve this problem. I have seen other videos online with the same issue. I have over 20 videos showing the system work and the system failing. The vin i listed is for the car on the dealer lot.
The contact owns a 2012 chevrolet malibu.the contact stated that while driving approximately 35 mph, she suffered a seizure and crashed into a telephone pole before landing in a creek. The air bags failed to deploy. There were no injuries and a police report was filed of the incident. The vehicle was towed to an independent mechanic where the contact was awaiting diagnosis of the air bag failure and repairs. The manufacturer was not notified of the failure.the approximate failure mileage was 70,000.
Airbag sensor goes off and on intermittently.has been that way since i purchased it from the dealership.it appears i was sold a vehicle with faulty wiring.this poses a health and safety issue as the dealership would not take responsibility for the airbag claiming it to be something that was my fault and that i should absorb the cost to repair it.luckily, i have not had any accidents however, in the event that one should occur; the chances of the airbag functioning properly are slim to nil.
My auto going thru green light intersection-struck on passenger side by auto who ran red light-damagedboth passenger side doors (both replaced)-other auto doing approx 45mph -did $8000 damage to my car-right side air bag did not inflate.
The contact owns a 2012 chevrolet malibu. The contact stated that when the vehicle was turned on, the service air bag light illuminated and stayed on. The dealer was not called and the manufacturer was not made aware of the failure. The vehicle was not repaired. The failure mileage was approximately 145,000.
Takata recall- service airbag light comes on intermittently.
I have been having problems with my air bag. I can have a passenger that weighs over the appropriate weight sit in the seat and the air bag light doesn't come on. I was driving one day and i made it to my destination and parked my car. I got back in my vehicle and started it up and the air bag light on my dash just came on and it will not go off. I went to the dealership and they told me that i will have to pay $3000 to get the vehicle repaired because they will need to take the air bag out and find out what the issue it. I feel that this is a defect, i did not have a crash or did anyone hit my steering wheel.
Driving to work,suddenly had to apply brakes hard to avoid hitting another car .after car came to a stop ,air bag service light cam on. Light stayed until next day then went out.now light come on at regular intervals .also had a hard time stopping, seemed like to a lot of pressure ,a great amount of pressure,i did not think car was going to stop.
The contact owns a 2012 chevrolet malibu. While driving various speeds, the contact rear ended the preceding vehicle. The air bags failed to deploy. A police report was filed. There were injuries that required medical attention. The vehicle was towed to an auto body shop. The manufacturer was not notified. The approximate failure mileage was 82,000.
My service air bag indicator keeps come gn on and going off
This is the second time that i pressed the brakes and the car failed to stop.both times resulted in collisions.the first time the car wss repaired and then given back to me.this time i was traveling approx 45 mph and the person in front of me slammed on their brakes.i went to do the same and the brake pedal went to the floor without stopping the car at all.i collided with the car in front of me causing major damage to my car and injuries to my shoulder, neck and back.
My service air bag light comes on at like every 3-4 starts it will turn off after i turn the car off i would like to know if this is a recall that is covered i just took my car in because the esc light was coming on and off and when it would come on i would lose steering i was once happy with my car but now i keep having all these light piping on and off
The contact owns a 2012 chevrolet malibu. The contact stated that the vehicle would not start and the air bag and check engine warning indicators illuminated. The contact stated that the failures occurred on different occasions. The vehicle was taken to cox chevrolet (2900 cortez rd w, bradenton, fl 34207,(941) 348-6417), but the cause of the failures could not be determined. The contact stated that the dealer made unknown repairs to the vehicle, but the warning indicators remained illuminated. The contact also mentioned that the vehicle was taken to a local tire shop for the replacement of the exterior lighting. The contact stated that every three months a different exterior light would go out and had to be replaced. The vehicle was not repaired. The manufacturer was made aware of the failures. The failure mileage was unknown.
I was rear ended and the steering wheel and shaft completely dislodged onto my lap .the air bag did not deploy. I was pushed approximately 150 ft. And there was no way i could have steered if there was another vehicle coming up the highway. If airbag would have deployed there would have been serious injury to myself.
Passenger air bag light comes on when car is in motion.
When turning on the carand when driving a message comes up saying "service air bag".the clock turns to military time without us changing it.seat belts sign comes when seat belts are being used.poor performance.
The contact owns a 2012 chevrolet malibu. The contact stated the air bag warning light illuminated. The vehicle was not diagnosed or repaired. The manufacturer was not notified of the issue. The failure mileage was 70,000.
I turned my car on this morning after sitting all night and the dashboard said service air bag. It was humid and hot the past few days. I looked up issues with 2012 chevy malibu's air bags, there are recalls for them but not for my vin. My car has not been in any accidents.
Takata recall - i was in a car accident on july, 12 on hwy 40 in st. Louis mo.both officers on the scene and the tow truck driver said the air bag should have deployed.the car was a total loss.i was going about 40 mph on the hwy, i ran into the back of a van, i was the last car of 4 cars .
The contact owns a 2012 chevrolet malibu. While driving at approximately 40 mph, another vehicle crashed into the front of the contact's vehicle. As a result, the air bags failed and the seat belts did not restrain the front driver and the front passenger. The contact and passenger sustained minor injuries, which required medical attention. A police report was filed. The vehicle was towed to an independent mechanic for diagnostic testing. The vehicle was not repaired. The manufacturer was not notified of the failure. The vin was unavailable. The approximate failure mileage was 55,000.
Had a broadside collision with impact to side of malibu that drove drivers door into drivers seat, pushing seat into center console. Side impact airbags did not deploy from this accident! b post was bent into passenger area also. Again no airbag deployment!
The contact owned a 2012 chevrolet malibu. The contact stated that while making a left turn, another vehicle crashed into the rear passenger side of the contact's vehicle. The contact stated that the steering wheel and steering column detached from the vehicle, which landed on the contact's lap. The air bags failed to deploy. The contact was concerned that if the steering air bag deployed, he would have sustained possible fatal injuries. A police report was filed. The front passenger sustained back bruises that required medical attention. The vehicle was towed to an impound lot. The vehicle was destroyed. The manufacturer was notified of the failure. The failure mileage was 33,000.
The contact owns a 2012 chevrolet malibu. While operating the vehicle, the air bag sensor indicator flashed off and on, which was a safety concern. Also, while driving, the rear trunk lid would erroneously unlock and open. The failures were not diagnosed or repaired. The manufacturer and local dealer were not notified of the failures. The failure mileage was 87,000.
The contact owns a 2012 chevrolet malibu. While driving 30 mph and attempting to stop for traffic, the brake pedal was depressed, but failed to respond in time. The contact's vehicle rear ended another vehicle. The air bags did not deploy. A police report was filed and there were no injuries. The vehicle was towed to a body shop, but the cause of the failure was not determined. The manufacturer was notified of the failure. The failure mileage was approximately 70,000.
Traveling at approximately 35mph on a city street. 2003ford pickup pulled out in front of our car.we hit drivers front fender. Our car veered off of truck rolling onto drivers side uprighting back onto wheels and stopped when it hit a barrier fence while crossing three traffic lanes of the four lane road.
The contact owns a 2012 chevrolet malibu. The contact stated that the air bag warning light illuminated. The vehicle was not diagnosed or repaired. The manufacturer was not made aware of the failure. The failure mileage was 88,920.
The contact owns a 2012 chevrolet malibu. While driving 40 mph, the vehicle stalled. The contact was able to restart the vehicle after some time. In addition, the vehicle failed to start intermittently. The air bag and anti theft warning lights illuminated. The failure recurred on numerous occasions. The vehicle was not diagnosed or repaired. The manufacturer was not notified of the failure. The failure mileage was 95,261. The vin was unavailable.
The contact owns a 2012 chevrolet malibu. The contact stated that while traveling approximately 40 mph, the vehicle's front end was crashed into by another vehicle. Upon impact, the air bags did not deploy. The passenger in the contact's vehicle sustained minor bruising. The manufacturer was not contacted about the failure. The vehicle was not repaired. The failure mileage was 47,000.
I was in a traffic accident and was bit on the driver side.the impact pushed in the doors and the side curtain airbags did not deploy.i was traveling approx 30 mph and the car ran a stop sign on a city street.
My car wouldn't crank then it would crank. Till i was driving down the road and it just died on me going around a curve lost control of steering and brakes thank god i didn't wreck so i got in line and researched and come to find out that it was something to do with fuel pump relay connection to fuel pump relay box. The wires aware too little voltage for the fuel pump and burnt wires to fuel pump relay box. I see that there are a lot of complaints on same car as line. So i'm filing a complaint cuase this is very dangerous.
I noticed an air bag light that appears on the cluster of my 2012 chevrolet malibu upon starting the car.it's not clear why this air bag light comes on, so i contacted gm and they claim they do not have any information on it.although my vehicle's warranty is no longer valid since it is more than 5 years, but the vehicle has very low miles (about 22k) and i believe gm should pay for the services for this issue to be diagnosed since it is safety related but they refused to pay for any services.i plan to take the vehicle to the dealer but i have no idea the extent of how serious the issue is, or how much it will cost for the repairs
The contact owns 2012 chevrolet malibu. The contact stated that while driving approximately 30 mph, while approaching a traffic stop signal another vehicle unexpectedly crashed into the driver's side. As a result, the vehicle began to travel across the road causing the front end to crash into an embankment and the air bags failed to deploy. The driver's sustained minor injuries and a police report was filed. The vehicle was towed to a salvage facility. The manufacturer was not notified of the problem. The approximate failure mileage was 16,000.
While driving a person slammed on brakes in front of me and i too hit mine. I did not feel the antilock while braking and after impacting with the car in front of me the airbags were not released. For as hard as we hit and for as much damage happened the police were surprised they did not deploy.
Since buying this vehicle, i've had trouble with the brakes, airbag sensors, electrical problems, seatbelt issues and also the airbag light, had a mechanic replace the airbag sensors in the rear, but the light still comes on. The brakes are now shuttering worse when i apply the brakes and it feels like the wheels are going to fall apart.
My service airbag message keeps popping up off and on. It has for weeks now? it seems this vehicle has been on the recall list several times for different issues? i have kept my vehicle maintenance up to date as i should however things like this keep happening! not to mention the buzzing noise i began hearing in the back of the car a couple months after i purchased it but you all claimed you could not find the problem. This is extremely discouraging! please let us know how these issues can be taken care of as this is a huge inconvenience and extremely unsafe!thank you.
When car is running, the service air bag soon light comes on and stays on while the car is running.
The contact owns a 2012 chevrolet malibu. The contact stated that the passenger side air bag indicator remained illuminated. The vehicle was driven to the dealer, but was not repaired. The manufacturer was notified. The vin was unknown. The approximate failure mileage was 110,000. Updated 01/25/2017*ct updated 6/29/18
2012 chevrolet malibu.consumer writes in regards to airbag recall issues.the consumer stated she never received a recall notice. The dealer informed her, the parts were not available.
Service air bag light on all the time car was in park when it first appear
The contact owned a 2012 chevrolet malibu. While driving approximately 55 mph, the contact lost control of the vehicle and crashed into a ditch and a truck. The front end of the contact's vehicle was severely damaged, but the air bags did not deploy. During the crash, the front driver side seat belt malfunctioned and unlocked. The contact sustained back, neck, and sternum injuries and was transported to the hospital for medical attention. A police report was filed. The vehicle was destroyed and towed away. The cause of the failure was not determined. The manufacturer and an unknown dealer were notified of the failure. The failure mileage was 74,000.
2012 chevrolet malibu.consumer writes in regards to body control module recall notice.the consumer stated while driving, the airbag deployed and caused him to have an accident. The consumer was injured.the consumer sent in a recall notice along with his complaint.
I have the airbag light going off and states to service the airbag. I have 80,000 miles on the vehicle. The airbag light will not go away.
The contact owns a 2012 chevrolet malibu. The contact stated that the air bag warning indicator randomly flashed. The vehicle was scheduled for an appointment on march 1, 2017 to inspect and diagnose the failure. The manufacturer was notified of the failure. The failure mileage was not available.
I bought my 2012 malibu about 2years ago and after warranty expiration i started having codes saying to service air bags but the codes won't stay constant and no one knows why for some odd reason. On top of that the passenger side head light has been changed 5 time in less then a year and a half and once again no one knows why. I'm not the only person with constant issues the manufacturer needs to be held responsible for faulty equipment
The front passenger airbag light always say it is off when a passenger is riding in the front
Takata recall i purchased a 2012 chevy malibu 2 years ago for my graduating senior and this car has practically been a nightmare since the day we purchased it.the current mileage is 43,000 and there has been so many problems with this car. The car previously shut down while riding on the highway, our mechanic stated the car has electrical issues. Okay, so he tampered with a few wires, and the car started right up. Two days ago, the car wouldn't start, it's currently displaying "check airbag" emergency lights are flashing, wipers began going back and forward. My husband began to shake a few wires (per our mechanic) , and long behold the car has started!!!talk about buyer's remorse!!!!this car is now parked in our garage until we figure out what to do with it!!!i'm now concerned for my son's safety and will not allow him too drive the 2012 chevy malibu.
The contact owns a 2012 chevrolet malibu. The contact stated that while driving at approximately 20 mph, the engine stalled without warning. The vehicle restarted. The air bag warning indicator illuminated and the service air bags soon warning message appeared. The vehicle was taken to a dealer where it was not diagnosed or repaired. The manufacturer was not made aware of the failure. The failure mileage was approximately 58,800.
The steering wheel tends to shake and turn left or right while you're driving almost caused a wreck idling it shakes really bad
While on a trip the passenger air bag warning light came on while driving on highways while on vacation. This happened in may 2016 and also may 2015 while on vacation. I checked on line and it states the air bag is disabled when the learning light comes on. On line it stated back in 2004-up through 2012 they had several complaints on this, they found a problem with the wiring harness and had to do upgrade called a soft recall.i called on star and asked about recalls regarding the warning light for air bag, they said no recall on that. I requested a case be opened on 6-2-2016and have not heard anything. Why would this warning light come on for a week every may? we do severalmiles of traveling mostly less than 300 one way trips yet it has only come on in may. I called my local dealership and they said no recall on that warning light either. Previously i had a 2009 malibu which i purchased mainly because of the safety of all the airbags. If i or may passenger is in danger at any time with the airbag disabled it's not safe, period.
My power steering goes out randomly. I can be parked it goes out, i can have my foot on the brakibg while in drive , it goes out. I can be driving anywhere and it goes out. The air bag light comes on randomly. And then my esc warning light comes on as well. In all of these instances it's all random when it happens.on 10/13/2018 m y power steering went out that is the most recent incident.
Passenger side airbag light for the front seat passenger always indicates that the airbag is off when a passenger is in the front seat. The message does not go away and has been happening for a very long time
The contact owned a 2012 chevrolet malibu. The contact stated that while driving approximately 40 mph, a second vehicle crashed into the front driver side of the contact's vehicle. During the crash, the front end sustained extensive damage, but the air bags did not deploy. In addition, the contact indicated that both the driver and passenger side seat belts failed and separated from the seats during the crash. The driver sustained back and neck injuries and the passengers injuries were unavailable. A police report was filed and medical attention was received. The vehicle was destroyed. The cause of the failures were not determined. The manufacturer was not notified of the failure. The failure mileage was 110,000. The vin was not available. Updated 09/15/15*lj
My son was driving my car down a two lane highway. It had been misting rain and the road was slightly damp... Approaching an intersection he reduced his speed to approx 40 mph. Two cars ahead of him slammed on breaks when the light changed to yellow. This caused a chain reaction... Cars sliding to prevent hitting the first car. My son said that he was breaking very hard when the anti-lock breaks engaged... They pulsed 3-4 times and then released which shot him straight into the back of the truck. He said that he was pushing the break as hard as he could when this occurred.the air bags did not deploy nor did the automatic crash response system work. I called on star to see if the system even shows a crash and it doesn't. I think that considering the crash bent the frame in the front end and is in excess of $6,000 you would think the sensors would have picked up on something. After the crash i contacted my dealer to ask if there were any recalls on this issue and was told there were not. I am very thankful that this crash did not result in a more serious injury / death.
At approximately 45,000-50,000 miles "service airbag" light would come on intermittently. Took into dealer, not covered by extended warranty because the seats were involved with the issue on some level.gm would not pay for the repair though the car was less than 2 years old.dealer did something and light stopped coming on.now at 85,000-90,000 miles the light is back on for days at a time. The light always comes on upon starting the vehicle.
On may 30, 2013, i noticed that the on light for the front seat passenger airbag would not illuminate when i sat in the passenger seat of our 2012 chevrolet mallibu.i am 66 inches tall and weigh over 100 pounds.i am an older adult -not a child.my husband and i took the malibu to hendrick chevrolet in merriam, kansas where we had purchased the car and complained that the airbag on light would not illuminate when i was in the passenger seat.the service advisor informed my husband that we should turn the airbag on.i wasn't present at the service desk to explain that the airbag would not come on no matter how many times i pushed the on and off button while sitting in the car.some time later, i was sitting in the passenger seat and my husband handed me our 17 pound dog.instantly the airbag on light illuminated.we returned to hendrick chevrolet on november 6, and explained that the only time the passenger airbag light would come on when i was in the passenger seat was when i was holding the 17 pound dog.we were informed that the airbag was controlled by a sensor that could not be adjusted.the repair report stated, "cust states that the passenger seat will not recognize his wife sitting in seat to engage airbag - she weighs 100 lbs.scanned system.no codes present, ck for programming updates.current. No repairs made or attempted. The system is designed to disable passenger air bag operation of (sic) occupant is lighter than pre determined limit with in the control module.operating as intended at this time."we hand delvered a letter to the hendrick service manager stating we were not satisfied with the service.we wanted a working passenger seat airbag.we have not heard back.
The contact owns a 2012 chevrolet malibu. While driving approximately 55 mph, the contact crashed into another vehicle. The contact stated that the air bags deployed but the entire air bag assembly detached from the vehicle. The contact sustained burns to her chest and injuries to the face because metal pieces from the air bag assembly struck her in the face. The vehicle was towed to a tow yard and was deemed as destroyed. The approximate failure mileage was 32,828. ..updated 12/05/12updated 12/07/2012 ..updated 12/03/14updated 06/1/2015
Power steering light comes on and my steering wheel is twitching and jerking.
My car was involved in an accident where my friend applied the brakes and was forced into hydroplaning into a barrier, another vehicle and a person. My airbags did not deploy as the sensor was not hit nor did the onstar become alerted that the vehicle had been in an accident. After fighting with insurance companies, my car was totaled then declared not totaled, and repaired. I received the notice of a recall much later after the car was in the accident.
The contact owns a 2012 chevrolet malibu. The contact stated that the passenger's air bag occupant sensor had become defective and would not recognize any occupant under 130 pounds seated in the passenger's seat. The contact took the vehicle to wally edgar chevrolet service (3805 s lapeer rd, lake orion, mi 48360) where a diagnostic test was performed and the contact was provided an estimate to replace the occupant sensor. The manufacturer was not notified of the failure. The vehicle had yet to be repaired. The failure mileage was approximately 100,000.
The contact owns a 2012 chevrolet malibu. The contact stated that while sitting at a complete stop, another vehicle crashed into the contact's vehicle while traveling 47 mph. The air bags failed to deploy and the seat belts did not tighten around the passengers. The vehicle was destroyed. The contact sustained neck and back injuries. The front passenger sustained neck, back and hip injuries. The rear driver's side passenger sustained neck, back and ankle injuries. The vehicle was inspected by the manufacturer however, the seatbelt and air bag failure could not be diagnosed. The failure mileage was approximately 15,000. The vin was not available.
The contact owns a 2012 chevrolet malibu. The contact stated that the air bag warning indicator illuminated sporadically. The vehicle was not diagnosed or repaired. The manufacturer was not notified. The approximate failure mileage was 70,000.
While driving down the highway the chimes started dinging and the cabin filled up with smoke the airbag light came on after pulling over it was discovered that the front seat belts were locked in the wearing position
The contact owns a 2012 chevrolet malibu. The contact stated that the air bag warning indicator illuminated upon starting the vehicle. The contact associated the failure with nhtsa campaign number: 12v224000 (electrical system). The contact called apple chevrolet (8585 w 159th st, tinley park, il 60487, 708-429-3000) and was informed that the vehicle was not included in any recalls. The manufacturer was not notified of the failure. The vehicle was not repaired. The failure mileage was approximately 130,000.
The contact owns a 2012 chevrolet malibu. While driving at approximately 25 mph, the accelerator pedal was depressed and traveled to the floorboard and caused the cruise control to malfunction. In addition, the seat belts did not latch and the vehicle crashed into a tree. The air bags failed to deploy. The contact sustained head, back, and legs injuries that required medical attention. A police report was filed. The vehicle was towed to an independent mechanic and repaired. The vehicle was included in a manufacturer recall. The manufacturer was not notified of the failure. The failure mileage was unknown.
The contact owns a 2012 chevrolet malibu. The contact stated while a passenger was seated in the front passengerā€™s seat, the passengerā€™s side air bag warning light would not illuminate. The contact stated there was no warning light illuminated. The vehicle was taken to a local dealer where it was diagnosed with the seat cushion pad needing to be replaced. The vehicle was not repaired. The manufacturer had been informed of the failure but offered no assistance. The failure mileage was approximately 115,000.
Was driving in the rain, vehicle does not handle well in inclement weather. Has issue with braking, tires skid.when i hit the gas pedal after a stop, the tires skid. . recently has a alignment done, and the tires are in very good condition. Thought maybe that was the issue, i was wrong.vehicle had recent inspection "brakes are in very good condition. Vehicle has had issues since purchase.my family and i were belted in as always, while driving the dash console light came on "service air bag" the light stayed on constant for approx. 30 min then went out. I have called the dealer and will have vehicle checked at appointment in 2 weeks.
Vehicle air bag service light activated. Vehicle checked by licensed mechanic and showed a code indicating a shortage in left airbag side. Exact location of short not yet identified.
1)air bag service light came on.12062018 (2) windows/electric constant problems. Several repair and correction same problem. )1st team mazda hpt va) window sticks, freezes, doesn't work. (3) drives bumpy. Sounds rough. Ran smooth before then several repeated same problems with car. (see maintainability. Log)(3) drive felt awkward. Had new tires, rotation etc. Drive is off. (4) can feel rough run while stationary, drive is not as smooth. (5) 1 recent incident. Parking lot female drive alongdrivers side front bumper. Repair 1st team mazda hpt va. 23666
Takata recall my airbag system warning comes on and goes off intermittently.my local shop said that they have run into many problems such as this and i was hoping that it was included in the takata recall.
Tamara recalli was told i that if i had gotten into a accident that the airbags would not deploy properly and it's going to cost me thousands to have it repaired .... This has to be a manufacturing error
In 2019, my vehicle's tail lights, blinkers, headlights, & interior lights went out. I began to receive dashboard notifications from my car about traction control in early 2018 and earlier this year i started receiving notifications of problems with my airbags. I bought new bulbs, but that didn't solve my lighting problems. I took my car to a chevy dealership and was charged/paid a large sum of money to be told i needed a new fuse panel and headlight bulbs. I was told the panel wasn't available due to a strike at the plant & to come back later to have the panel installed. I returned later to be told that the tech didn't record his findings on my profile so no one knew what was wrong with my vehicle and was asked to pay out more money. Therefore, i took my vehicle to a different dealership and it was documented that my vehicle required a substantial amount of wiring which includes, but not limited to, body control module (bcm), body harness, a new fuse block, labor, etc., the price tag is in the thousands. I conducted online research and learned of recalls on my vehicle. I contacted chevrolet and was told there was no recall on my particular vin although there is a recall on the year, make and model of my car and there was nothing chevrolet could do to assist me. However, for every single issue i am experiencing with my car there is a recall for it. I am unable to drive my financed vehicle due to safety hazards and the possibility of being ticketed by the police or worse.i received notice for one recall after purchasing my car and that was for a seat belt. From my understanding 13036 is the bcm chevy recall number. Please let me know if more information is needed.
My car won't go when stepping on the gas peddle in drive. When i stop at the light or to brake the car won't go when pushing the gas peddle in drive it doesn't do anything. I had to have the car towed 2x due to this issue. I only have 67k miles on this car. I've been told it's the transmission problem and need a new one. This should not be happening with the car. This is danegerous and unable to drive at this point. The dealer won't do anything about it. I should still have the warranty of driver train and nothing is being done. I've read several complaints of the same exact car having this issue obviously it's a defect. I want to contact gm about this i was almost killed when my car won't go stuck at a intersection. Also the recall on my seatbelt : steering the dealer is saying no active recalls which there is. I'm getting frustrated with these issues and nothing is being done. I'm reaching out to every entity possible before something happens to me or someone else with this faulty car. The airbag fault like occasionally comes on for no reason at all, then goes off then comes back on. These are issues that the gm needs to rectify. After reading online about the many same issues the 2012 malibu has gm needs to intervene and help the owners get these faults fixed. There are way too many online complaints. [xxx]please helpinformation redacted pursuant to the freedom of information act (foia), 5 u.s.c. 552(b)(6).
Air bags light keep coming on had a recall to have it replace before but light came back on
My 2012 chevy malibu has a problem with the passenger air bag system. At random times the passenger airbag off light will turn on when the seat is occupied (by someone >120 lbs) also at the same timeif the passenger unbuckles the seat belt the seat belt warning light does not come on. I have several videos of this failure while sitting still and while driving. Dealer replaced the passenger sensing sensor and control module. This has not fixed the problem. Dealer said because the passenger sits with one leg tucked under the other that this is the cause. Not buying it because it does not always fail like that. We have duplicated the problem at the dealership with the service adviser and the technician. I can get the system to reset by cycling the key to off and then restart the car. This is not the fix just the patch. Sometimes the problem happens when using the remote start and the passenger gets in before the key is turned in the ignition switch. I have been in contact with gm about this.
Was operating the vehicle on the interstate when i was forced to brake and hit the horn to avoid a collision. The "service airbag" light came on and stayed on. I found that by hitting the steering wheel it would go out and reset. Every time i use my horn causes the "service airbag" light to come on. Sometimes it goes out again on its own. Unsure if the airbag would deploy while the light is on.
Repair air bag light comes on when turning car on. The light beeps majority of the time the car is running.
My wife was driving east down hwy-40 toward salina, ks. She had the cruise control set on 60 mph. She began to have a epileptic seizure (she was cleared by her doctor to drive prior to this incident) at that point the car began to slowly drift of to the right side of the road. The car drove over a culver, the rear driver side of the car struck at concrete form and sent the car rolling of into a field the car rolled four times. After the fourth roll the car rolled back on to its wheels and continued to drive due to the cruise control still being engaged and drove 100ft before coming to rest once it struck a concrete fence post. At no time did any of the air bags deploy nor did the cruise control disengage.the vehicle has a crash response system threw on-star, at no time did the crash response activate. This information was provided to me via the saline county sheriffs. My wife only suffered minor cuts and bruises.
The contact owns a 2012 chevrolet malibu. The contact stated that air bag warning light illuminated. The failure recurred several times. The vehicle was taken to the dealer for diagnosis. The vehicle was not diagnosed. The vehicle has not been repaired. The manufacturer was not notified of the failure. The approximate failure mileage was 70,000.
One day i turned on my car and my tire sensor was malfunctioning, my airbag light was on and "airbag service needed" notification was showing, and there was nothing that happened other than me driving to work 3 miles away that would have caused the smell functions. In addition these, earlier in the year the were a few months where i was bringing my car in and out of the shop trying to figure out why it was not starting at times. I've got the fuse box fixed and it seems to have fixed the problem but i believe it has something more to do with the computer processing unit
The contact owns a 2012 chevrolet malibu. The contact stated that while driving at approximately 35 mph, the air bag warning light illuminated. The failure recurred intermittently. The vehicle was taken to the dealer where it was diagnosed that the seat belt pre-tensioner and an unknown connector under the vehicle seat had failed and needed to be replaced. The vehicle was repaired but the failure recurred. The manufacturer was notified of the failure. The approximate failure mileage was 32,490.
Tamara recall my low beams lights keep going out and on, it does this when park, and driving they work sometimes one or the other sometimes they won’t come on at all.
Low beams repeatedly going out, both sockets replaced and bulbs, numerous times. Front bumper facia has to come off for replacement
Randomly doesn't what to start been to shop several times mechanicgoes to fuse box and mess with wiring and starts upi go through this problem several times for months now. Tired not having a car to get to work mechanic can't figure out why it dong this need recall on it several complaints i read about already same as me. Also one time act like was going to stop downtown in traffic pull off side road call ed mechanic.
My engine light came on, so i shut the car down and restarted, engine light went off, however when i pulled out of parking space, i noticed a grinding sound coming from the front of my car, then my breaks starting squeaking really bad. Now i constantly hear that sound when starting my car in early mornings, the squeaking is constant.also my radio and defrost goes in and out, my radio shuts downby itself and then returns on, my back defroster doesn't seem to work, when it rains, my back window is not defrost, so i can't use my back window for viewing when we have heavy rain or extremely cold weather.
The contact owns a 2012 chevrolet malibu. The contact stated that the vehicle would not start and the security warning indicator illuminated. The vehicle was taken to an independent mechanic where it was not diagnosed. The vehicle had the fuel pump and key fobs replaced, but the failure recurred. The manufacturer was not notified of the failure. The approximate failure mileage was 55,000.
Blower motor pulled so much amperage from engine/battery that it melted the wiring harness and blew the blower motor resistor.was driving the vehicle, and had the air conditioning on. When accelerating, the blower cut off and i could only feel the air slightly coming from the ac vent. Had it diagnosed at my mechanic and he indicated that he'd seen this many times in chevys and that there had to be some defect in the blower motor for it to pull so much amperage -- enough to melt the wiring harness, which subsequently blew the resistor.
Car stops while driving loses power. Start and stop intermittently.fuses hot in trunk fuse box.was nearly rear ended multiple times.this has been an ongoing problem and have had many parts replaced which has not fixed the problem. This is however, the third time it has happened while driving.this is a very dangerous situation! i have heard of many other vehicle owners of the same make and model having these issues. This is a wiring issue with general motors.someone is going to get injured or worse due to this issue.
My 2012 chevy malibu passenger side low beam has gone out for the second time in less than a year. After doing some research, i found this is a common issue for the chevy malibu. Entries stating similar issues specifically effecting the same passenger side low beam, totaled more than 300 on carproblemzoo.com this is not only a monetary issue, not only a resource issue, but a significant risk to operator and bystander safety.if gm does not acknowledge they have supplied a faulty product, as described by the hundreds of complaints listed online, they are complicit to any accidents or injury caused by their lack of action and concern. My own experience has been frightening, noticing a lack of power after i'm already on the road,only seeing one light from my car reflecting on another car or surface. The general public takes great care to make sure their vehicles can both safely operate and transport themselves and others. With this damaged part in chevy's malibu, making great strides for a safe vehicle could be for nothing if the light does not do its job. With this in mind, please consider the climate we live in today. The difference between a faulty headlight, and a reliable light, could mean life or death not only for those on the road, but for poc, targeted by police, for a faulty headlight. In 2015, darrius stewart was a passenger in a 2009 chevy malibu. He unjustly lost his life to a police officer after the driver was pulled over for what do you ask? a headlight out. Darrius stewart. General motors- recall. Http://chng.it/rpxwymbw9v
The contact owns a 2012 chevrolet malibu. The contact stated that the headlight connectors were melted and had to be replaced 7 times within the past three months. The vehicle was taken to an independent mechanic where the contact was informed that there was too much volts going to the headlight wiring connectors causing the connectors to melt. The vehicle was taken to van chevrolet (100 nw vivion rd, kansas city, mo 64118, 816-527-8564) to be repaired. The vehicle was repaired however, a week later the failure recurred. The vehicle was not repaired. The contact emailed the manufacturer and received a response which stated that they were aware of the failure however, no additional assistance was provided. The approximate failure mileage was 140,000.
I have a 2012 chevy malibu and since november we have had headlight problems and changes bulbs and got a new wire harness and we still have problems with passenger side low beam light going out. It is a real pain cause it takes a bit to even get to the headlight. Have to take the bumber off and real frustrating.
The contact owns a 2012 chevrolet malibu. The contact received a recall notice for nhtsa campaign number:14v252000 ( electrical system , electronic stability control , exterior lighting , service brakes, hydraulic , vehicle speed control) and stated that the part needed was unavailable to perform the repair. The manufacturer was notified of the issue. The contact had not experienced a failure.
My fuse box in my trunk came back fail bad one so changed it out with another one well that worked for 1 month my car stalls or don't start unless i hit the fuse box got another fuse box that did the same exact things now some times when i hit the fuse box my car will start then again won't somethings making the fuse box to go bad i believe it's something to do the wiring or fuel pump relay fuse. I've had my car stall on the high way to many times this need to be recalled its a hazard problem not safe.
The center brake light doesn't work. I put in a new led light assembly in and it still doesn't work.
While driving passenger side low beam stopped working, then came back on after a few days. Now both passenger and driver low beams are not working. High beams are fine. I always used the automatic lighting to have them turn on/off for anytime i drive. Low beams required new headlamps and melted relay, replaced that as well. Service esc and traction control lights come on dash, then turn off, then come back on. It is intermittent and won't ever stay on long enough to have checked. Usually it happens when stopped at a stoplight and then when you start to accelerate again it goes off.
Car was parked with rear defogger and heat running, loud explosion cracking noise and the rear windshield had exploded into spiderwebs.got out of the car to inspect the damage -- other people parked saw the incident and no one saw anything hit the windshield ( parked at school dropping off kids ).nothing was found that indicated the window had been struck in any way.the rear window defroster was warm to the touch in several areas of the spiderwebbed window.outside temperature was approximately 0 degrees.car had been running for about three hours.
I have a 2012 chevy malibu lt and at random times the car will shut down, while driving, while being stationary, and sometimes it don't even start when it's been off i took it to multiple mechanics and they couldn't detect any codes or seem to find the problem they changed the fuel pump, the fuel pump relay, the fuse, the ecm starter ignition coil, battery, alternator and the car still doesn't start randomly i have to turn the car to the on position then off more than 30 times and wait until i hear the fuel pump activate then i know it will start i have had the car cut off on me on the freeway, in the middle of malik a turn on busy streets i've been out at family events and when i tried to go home the car wouldn't start i need help
The contact owns a 2012 chevrolet malibu. The contact stated that the steering failed on the vehicle. The failure caused the contact to drive into a snow bank. The contact stated that the power steering light illuminated on the instrument and the traction control light illuminated on the instrument panel. The contact stated that the failure prevented the vehicle from being steered. The contact spoke with the manufacturer and was informed that the electronic steering module was not under recall and that the vehicle was not included in nhtsa campaign number: 14v252000 (electrical system) even though the body control module needed to be replaced. The contact received this information from a senior safety supervisor from gm. The failure occurred four times. The vehicle was not repaired. The vin was not available. The failure mileage was 61,000.
The contact owns a 2012 chevrolet malibu. The contact stated that the steering wheel abruptly locked while attempting to turn at a low speed. The failure was experienced several times. While the bluetooth was in use, the radio and steering wheel simultaneously failed. The vehicle was taken to the dealer where it was diagnosed that the battery cable was defective and caused the electrical system to lose charge. The vehicle was repaired. The battery cables were replaced and routed correctly. The manufacturer stated that the cable failure was due to wear and tear. The failure mileage was 47,607.updated 09/20/16*lj*as
The car had gm service bulletin 13036 (recall campaign 14v252) performed on september 19, 2014 and the car is experiencing the exact same conditions as described in the service bulletin[1] so the "fix" didn't resolve what is now an on going safety issue.it should be noted in the recall "why" section to owners the use of "...over time...".therefore, the issue is known to be time dependent and the fix doesn't appear to fully resolve the issue into the future.1: we are currently seeing the following conditions:- service brake lamps may not illuminate when the service brakes are being applied.- ifcruisecontrolisengaged,additional service brake pedal travel may be required to disengage it.- traction control, electronic stability control, and panic braking assist features, if equipped, may be disabled.- service esc and/or traction control tell-tales may illuminate with this condition.
While driving i noticed my lights showing engine power reduced from myunderstanding this is the throttle position sensor.
Since i purchased my car in the later part of 2012 (used with 40000mi) i have had several incidents starting with the radio, when i turned on the rear defrost the radio would go to complete static on all stations.while traveling approx. 30mph the service engine light would come on then after stopping the car and restarting the light would go off as well as minimal turning to the right the service esc light would display, in addition to the remote start not working half the time, i have replaced the key fob and gotten a new key and still the same problem exist. The dealership has replaced the radio with a brand new part and still the stations are not clear and while sitting in the car parked all of the lights in the dash sometimes come on for service and the car would idle low then high.the lights in the dash will sometimes completely dim and the display on the radio will be digital. My car now has about 65000 miles on it, and still the car sometimes stalls at stop signs, will be without power and the service esc displays as well as service engine. This has happened too many times to count at this point. Tuesday may 6 2014 my husband was driving approx. 25mph all the lights in dash came on and engine stalled on him so herestarted the car, upon restarting all the lights in the display turned off. Saturday may 10 2014 the radio was complete static...this is a constant issue, i keep my gas tank plentiful and have only owned gm vehicles. I am researching other makes at this point.
Engine losses power shuts off wont restat
Both headlamps have gone out within a nine month period. The driver side has been changed twice, the passenger side once. It seems every three months a headlight burns out on my car. As for the wipers, when they are turned on, they swipe halfway and stop until i turn them off and back on or to a higher swiping speed. This has happened as the vehicle was in park and drive. Also, the key fob battery has been replaced twice and works seldomly. The locks have recently starting locking on their own after the vehicle is shut off and the driver door is shut.
The contact owns a 2012 chevrolet malibu. The contact had the vehicle repaired under nhtsa campaign number: 14v252000 (electrical system, electronic stability control, exterior lighting, service brakes, hydraulic, vehicle speed control); however, the failure recurred. While driving approximately 45 mph, the traction control warning indicator illuminated. The vehicle was taken to a dealer where it was diagnosed that the bcm module needed to be replaced. The vehicle was not repaired. The manufacturer was notified of the failure. The approximate failure mileage was 22,000.updated 02/12/16*ljthe consumer has since sold the vehicle. Updated 02/22/16.
Esc warning light comes on and traction control. Brake light stays on while driving and when you brake goes out.didn't have any brake light on at red light and was almost rear ended multiple times.just an fyi i notice this has been a problem on other malibu's and was recalled why not this one with the same problem.
While driving the car the check engine light cameon and warming message read engine power reduceesc and service traction control.. The car shook and dropped down to 30 mph whilei was on highway ..i was barely able to get to side of highway .. I waited a few minutes and started car back up again message cleared but right before i got home car did the same thing .. I called triple a and has it towed home
Headlight lamp constantly goes out despite changing out the bulb and/or the fuse multiple times.it is becoming a hazard when driving on the roads.
Rear fuse block melted at fuse location 23 for rear window defogger2nd occurrence on vehicle.rear defogger illuminated on dash indicating that defogger was on.was not working properly.opened rear fuse block in truck to examine fuse and found fuse had melted and fuse block is also melted showing potential for fire hazard.fuse was charred and blacked and hard to distinguish 30 amp rating on fuse.fuse block plastic at wires is also melted.pulled fuse and defogger relay to prevent further damage to fuse block.this is the second time this has happened to my vehicle as first was still under factory warranty (2015).known timeline for fuse finally blowing and preventing system to work is 11/24/18.system worked prior to that. Search of internet has reviled more vehicles having similar problem.possible safety issue. Can provide pictures of fuse and block upon request.
The contact owns a 2012 chevrolet malibu. While the vehicle was parked and attempting to remove the key from the ignition switch, the vehicle became inoperable. The vehicle was taken to the dealer where it was diagnosed that the ignition switch failed and needed to be replaced. The vehicle was repaired. The manufacturer was not made aware of the failure. The failure mileage was 20,557.
Driving and car had severe electrical problem that caused the car to randomly stall while driving. We lost power steering and power brakes. The instrument panel starting going crazy displaying all lights, saying device esc and the doors locked and unlocked. The engine stalled and transmission started jolting around. The car would not turn back on after turning it off. Took the car to starling chevrolet to get it fixed the following monday since closed sunday. Before taking to the dealer took the car to auto zone to check the battery. Autozone stating battery was great. Chevrolet didn't look at the car at all monday, and tuesday stated we need new battery. I advised of auto zone reading and was told autzone was wrong. Picked up the car tuesday after having a brand new battery put in for $270. Today is the following friday and the car did everything again while driving and will not start. Now i have to tow the car to chevy again.
Vehicle was in motion at about 60 mph on a highway and the rpms dropped drastically, the anti skid indicator light came on, the vehicle lost power temporarilly. I pulled over and slowed down and the car returned to normal. Same evening vehicle was in motion about 55 mph on a highway when there was a loss of power, steering got sluggish,all indicatorlights on dash blinked on and off engine light came on and stayed on, anti skid indicator light came on, was knocking in motor and car would not accelerate over 20 mph. Completed a diagnosis of the vehicle and a code p0068 was noted by diagnostics.p0068the engine and transmission system is not performing as expected. An issue has been detected in the throttle control system that connects the accelerator pedal with the throttle and integrates features such as cruise control, traction control, stability control, and pre-crash systems. If the check engine light is flashing, a misfire condition has been detected. A misfire increases vehicle emissions and could damage the emission control system on the vehicle. Please reduce vehicle speed, avoid hard accelerations, avoid steep uphill grades, and reduce any cargo loads such as a trailer. If the vehicle is continually driven with the check engine light on, the emission controls might not work as well, the vehicle fuel economy might not be as good, and the engine might not run as smoothly. This could lead to future repairs
Having issue with passenger side low beam light after replacing it still see the light goes in and out i looked up the issue online and see many people are having the same issue on the same side of the vehicle with the passenger side light and everybody experiencing the same problem the light will go in and out even after you replace the bulb.
Power steering light comes on and my steering wheel is twitching and jerking.
One day i turned on my car and my tire sensor was malfunctioning, my airbag light was on and "airbag service needed" notification was showing, and there was nothing that happened other than me driving to work 3 miles away that would have caused the smell functions. In addition these, earlier in the year the were a few months where i was bringing my car in and out of the shop trying to figure out why it was not starting at times. I've got the fuse box fixed and it seems to have fixed the problem but i believe it has something more to do with the computer processing unit
In june 2014 car wouldn't start after sitting 4 hours towed in said theft system made new key which i had to pay for, towed in again 3 days latersame problem,started for dealer in am another $120.4 days approx later again got to work then wouldn't start. Replaced rear u-bec, wiring harness junction block, relay, because melted connector with five leads 30 amp fuse. Then 9/23/2014 car started got to daycare within 5 minutes of being off no start. Waited then started ten minutes later. 9/272014 got to work lunch time no start same wanted to start like getting no fuel then 3 hours later started drove to dealer.
When driving or sitting at idle not moving service esc and traction control flashes on dash. Which is causing check engine light to stay on causing misfire on cylinder #1 and then random misfire. The car hasn't been able to be inspected in 2 years have had at 3 chevrolet dealerships and all can't figure out issue . The 1st dealership said we have no idea what's wrong with the car. The second dealership said the car needed #1 injector and injector harness and throttle body which was replaced didn't even make it off the lot and check engine and traction control and esc lights was flashing again they said might have cracked head car has been pressure tested doesn't use water and doesn't get hot. They are just trying to throw parts at it at my expense. The 3rd dealership which car is at now is telling me possible burnt valve causing all my issues with car said they did compression test and all cylinders have 170 pounds in all 4 cylinders which is not possible. I have replaced map sensor, pcm, spark plugs, 1 injector, injector harness, throttle body and nothing has helped car. The car never had any issues with misfire until the esc and traction control started flashing and in 2 years still has been solved at any dealership very disappointed in need of help to fix issue
Car starts and after 2 seconds turns back off. Car will start again and drive fine for hours and then it will happen again. Problem is intermittent but no one can figure out the problem and diagnostic won't read the problem. No check engine light.
2012 chevrolet malibu. Consumer writes in regards to nhtsa safety recall 14v-252. *ldthe consumer stated after the vehicle was repaired under the recall, the failure recurred. * js
We have talked to out two different chevy dealers about this and even went through arbitration over our airbags. Nothing has ever been found to be wrong. The service air bag light has come on again. I was driving approximately 30 mph and the service air bag light on the display come on momentarily (about 60 seconds) and went off. It came on for about 15 seconds and started flashing, then it stayed solid again. Now, every time i start the car, it is on.
When turning on the carand when driving a message comes up saying "service air bag".the clock turns to military time without us changing it.seat belts sign comes when seat belts are being used.poor performance.
The contact owns a 2012 chevrolet malibu. After driving various speeds and depressing the brake pedal, the entire instrument panel illuminated and flashed intermittently. The vehicle was not diagnosed or repaired. The contacted called an unknown dealer who stated that the bcm brake sensor module would need to be replaced. The vehicle was not repaired. The manufacturer was notified of the failure and stated that the part would be replaced. The vin and failure mileage were not available.
Esc warning on dash coming on will driving and turning forward or backward. Hvac controller not responding to commands,hvac resistor and blower motor wires getting very hot and not blowing fuses when driving with ac or heater running. Hvac resistor blowing out. High motor oil consumption , every 1000 miles its low a quart.
2012 chevrolet malibu.consumer writes in regards to body control module recall notice.the consumer stated while driving, the airbag deployed and caused him to have an accident. The consumer was injured.the consumer sent in a recall notice along with his complaint.
Head lights keep going out
The contact owns a 2012 chevrolet malibu. The contact stated that the engine overheated, stalled, and various warning indicators illuminated. The vehicle was towed to the contact's residence and was later taken to master chevrolet (3625 richland ave w, aiken, sc 29801, (806) 353-6343) for diagnostic testing and repairs. The contact stated that the dealer was unable to determine a specific cause of the failures, but stated that the vehicle was a flood vehicle. The vehicle was not repaired. The contact also mentioned that the vehicle had electrical wiring issues, the transmission failed to switch gears correctly, and the brakes had been replaced at least twice since owning the vehicle. The manufacturer was not notified of the failures. The failure mileage was 99,500.
The interior light panel went completely dark, after a few minutes it lit up again.this has been happening more frequently lately. The radio stops playing and the panel reads"auxiliary mode".i have to turn the radio off and on for it to start playing again.it is happening more frequently. When i plug in my auxiliary cord to listen to my ipod, it shorts out.the clicker to unlock/lock the car stopped working so i went to get a new battery. They tested the battery and said it was fine.my rear defroster does not work at all.
The low-beam headlights keep burning out.a melted socket was the first issue.it was repaired a month ago and now the same problem is again at play.there must be an electrical short.this is a common problem with these vehicles that many have reported. It costs dearly to have a mechanic take apart the front of the vehicle and work on the lights since you must take off the whole front bumper to access the headlights.i have paid for repair and bulb replacement already in the past 2 months.to see it happening again is very discouraging.
Head light keeps popping off and on and when running an obd test after clearing codes several times it 1st provided me with 2 codes then 9. Two hours later 32 codes popped up. The buttons on the streinng wheel cut in and out at random.## vin passed ## chevrolet malibu 2012 ##
My driver side light continues to keep going out after a couple weeks and the bulb is not blowing this is a common problem with the chevy malibu definitely needs to be recalled and fixed because if you don't have headlights can cause a bad accident. If you hit a bump it goes out. I was on a back road at night and both lights went out almost causing me to crash
My stationary car would not start one morning , after having it towed to a independent auto shop i was told the relay switch was replaced but the car had and electrical problem that might reoccur and should be taken to a gm dealership. Two weeks later the stationary car would not start again and i contacted gm customer care line and scheduled to have the car inspected, before i was able to arrive at the dealership the car started without issue and i was able to drive the car. I took the care to the gm dealership and the problem could not be found. Another 4 days passed and after i started my car and while in motion it shut completely down and would not immediately start, i sat for maybe 10mins and the car started up without an issue. Another week passed after that and the car would not start after i parked it for around 1 hour. The car was taken back the gm dealerships where it was determined there were 2 shortages . There is a faulty section of the rear terminal and my terminal in section a10 had to be replaced.
The interior light panel went completely dark, after a few minutes it lit up again. This has been happening more frequently lately. The radio stops playing and the panel reads "auxillary mode"and then back to radio, then back to "auxillary mode". I have to turn the radio off and on for it to start playing again. It is happening more frequently. When i plug in my auxillary cord to listen to my ipod, it shorts out. The clicker to unlock/lock the car stopped working as well, so i went to get a new batery. They tested the battery and said it was fine. Also my rear defroster does not work at all now.
I was driving on a side road, when all of a sudden my car just shut down and i coasted to a stop.i was stranded in a turn lane for about 20 minutes.during which time i had already called a tow truck as i could not get my car started again.after the 20 minutes i thought i would give it another try and it up and started, and i drove back to work.i made it home that night, but was stranded again when i left the place.i was headed home and it stopped one more time before i made it there.i took it to an auto shop the next day and made it fine.the auto shop did a test drive and it stopped on a road and they failed to get it started.it turns out it is for an ignition switch, which there are recalls for other gm vehicles for the same part, just not a 2012 malibu.so i have to pay to get it replaced and hope for an extension of the recall for the chevy malibu.
My power steering just went out on me in the middle.of driving got real stiff on the 10 freeway going home from.redlands to hemet and my power steering eis electrical and its hard my mechanic said its too much to fix and told me that its a high demand in recall for this and that i need it fix i turned it on and ti works for 5 minutes a drive or two and out of no where even while driving will stiffen up again on me
The contact owns a 2012 chevrolet malibu. While driving various speeds, the vehicle stalled without warning. In order to restart the vehicle on the first attempt, the contact had to lock and unlock the doors; however, the failure recurred. The vehicle was not diagnosed or repaired. Also, once the vehicle restarted, the security and check engine sensors illuminated. The manufacturer was not made aware of the failure. The failure mileage was approximately 28,000.
Replaced low beam lights multiple times, had the wiring harness replaced due to a shortage that was supposedly leading to the low beams light blowing out constantly. Low beam lights still keep going out. Ongoing issue
My car will randomly not start. I have bought a brand new battery. That wasn't the problem. A week later, my gear shift wouldn't move. I had to stay in my vehicle and miss an appointment because of this. I couldn't get it to move from drive to park. After several tries and 30 minutes, it finally moved. It's gotten stuck a few times trying to move it from park to drive as well. And when i'm driving, the emergency lights will randomly illuminate and wipers won't work. I was driving when it was pouring rain and the wipers wouldn't turn on with all emergency lights illuminated as well. This can happen anytime i'm on a city street going from 25 to 45 mph. I have had to have it towed several times to different shops and they can't tell me what's wrong.
The contact owns a 2012 chevrolet malibu. While driving at various speeds, the vehicle stalled. The vehicle was restarted and operated as normal. The failure occurred on multiple occasions. The vehicle was taken to the dealer several times but the failure could not be duplicated. The contact also stated that the vehicle would fail to start on several occasions. The manufacturer was notified of the failure. The failure mileage was 53,000.
I've had read so many vehicles with same issues on all these models i just purchased this car put a high down payment to be getting left everywhere all chevy dealers dont know where to start and over price it all you all should look into it because its something serious . Car wont start after being used a while, you have to mess with cables and wires for it to start mess with fuse boxes and also sometimes it doesnt work.. Do something about it i'm annoyed of this crap
The contact owns a 2012 chevrolet malibu. The contact stated that there was a burning odor coming from the rear of the vehicle. The contact also stated that the rear defrosted failed to function. The vehicle was taken to an independent mechanic who replaced the fuses and noticed sparks. The failure recurred. The vehicle was taken to a dealer who replaced the fuse or junction box. In addition, the contact stated that while driving during inclement weather conditions, the windshield wipers failed. The vehicle was taken to a dealer where the windshield wiper transmission was replaced. The vehicle was included in nhtsa campaign number: 15v269000 (seat belts) and was unable to determine when the part would become available for the repair. The manufacturer was notified of the failures. The approximate failure mileage was 48,000....updated 02/19/16 updated 10/25/2017
Gm tech bulletins say there is a ghost problem with elect. Stability controller.gm mentions there is no recall or known cure for this..components/contacts were cleaned at serv.shopbut " serv. Esc-esc off"keeps appearing in "driver display"when hitting bumps -turning car.. I will mail service sheets. This option was available on 08-09-10 models of malibu but std. Onmy 2012 car.it is worthless when there is thick snow..i will send , by mail, serv. Records on this unsolvable problem...it continues to happen ,at slow speed -not just one time...i believe you can read the g.m.-tsbs, as it was shown to me....
The contact owns a 2012 chevrolet malibu. The contact received a notification for nhtsa campaign number: 14v252000 (electrical system, electronic stability control, exterior lighting, service brakes, hydraulic, vehicle speed control). However, the part needed was not available. The dealer indicated that it would take months before an appointment could be scheduled. The manufacturer was contacted and could not provide an estimated date for when the vehicle would receive the recall repair. The contact did not experience a failure.
I am an auto mechanic and the owner of a 2012 chevrolet malibu. The problem with my vehicle, 4 of my customers malibus (2009 to 2012) and many many other malibu owners is that while driving one or both headlights will cut off leaving the operator with little or no visibility while still in motion, this is what happened to me one night on a rural highway with no street lights. After much troubleshooting i have discovered the culprit to be that the headlight sockets overheat and melt causing a loose or open connection from the wiring harness to the headlight. Since then i have replaced many sockets (including my own) and they have been 100% successful. In summation i believe driver and occupant safety is significantly reduced due to the poor manufacturing and the subpar integrity of the headlight sockets. Thank you for your time and consideration.
The contact owns a 2012 chevrolet malibu. The contact stated that the key was unable to start the vehicle on several occasions. The vehicle was taken to a dealer, but the failure could not be replicated and no diagnostic trouble codes were shown. The vehicle was taken to a mechanic for further inspection. The manufacturer was notified of the failure. The failure mileage was not available.
The fuse box in trunk of car has a short in the wire and it is causing a burning smell. The vehicle doesn't start half of the time and when it does start, the car will stall out or completely shut down without warning. This is unsafe especially in traffic with the kids.
Vehicle has the check engine light come on and reduced power kicks in with no warning.vehicle has been driven at speed on highways when this happens and automatically slows to 40 mph.vehicle has been taken to the dealership and repairs made the first 2 times, vehicle has been taken back 3 more times for the same issue, no codes showing in the computer.issue also reported that if at a stop, vehicle has no response when you step on the gas.the dealership is currently trying to report this as a different issue so they can avoid dealing with the lemon law in the state.
The contact owns a 2012 chevrolet malibu. The contact stated that the air bag warning indicator illuminated upon starting the vehicle. The contact associated the failure with nhtsa campaign number: 12v224000 (electrical system). The contact called apple chevrolet (8585 w 159th st, tinley park, il 60487, 708-429-3000) and was informed that the vehicle was not included in any recalls. The manufacturer was not notified of the failure. The vehicle was not repaired. The failure mileage was approximately 130,000.
Headlights keep going out after being changed multiple times
At 1st my car wouldn't crank every so often then started going drag while driving i googled it and had to beat on fusebox in trunk or wiggle wires so had to run wire straight to battery to fuel pump. My headlights on dim keep shooting and my speakers will go out sometimes
The contact owns a 2012 chevrolet malibu. While driving various speeds above 40 mph, the instrument panel lighting failed to remain illuminated as the steering wheel seized. The vehicle was towed to lasorsa chevrolet buick dealer where it was diagnosed with an oil pressure valve malfunction. The dealer was also informed that the check engine indicator illuminated. The vehicle was repaired for the oil pressure valve, but the dealer failed to diagnose the instrument panel and steering wheel failures. The instrument panel and steering wheel failure recurred and the vehicle was towed back to the dealer. The diagnosis was unknown. The manufacturer was not made aware of the failures. The failure mileage was approximately 65,000.
The contact owns a 2012 chevrolet malibu. The contact stated that there was an electrical short with the wiring associated with the headlights. The low beams, high beams, running lights, and turn signals failed to function. The vehicle was inspected, diagnosed, and repaired by a mechanic. The manufacturer was notified of the failure. The approximate failure mileage was 125,000.
Low beam lights continuously going out. Bulb is still good. Have replaced bulb. Took the vehicle to the chevy dealership. They replaced some wiring or harness. Now passwnger side low beam is out again!
While driving down the highway the chimes started dinging and the cabin filled up with smoke the airbag light came on after pulling over it was discovered that the front seat belts were locked in the wearing position
Fuse 6 blows when left turn signal is activated.it first blew in oct 2018, then not again until december (several times) and still happening again in jan 2019. Signals will work fine for a day or two after replacing fuse, but then fuse blows again.
I bought my 2012 malibu about 2years ago and after warranty expiration i started having codes saying to service air bags but the codes won't stay constant and no one knows why for some odd reason. On top of that the passenger side head light has been changed 5 time in less then a year and a half and once again no one knows why. I'm not the only person with constant issues the manufacturer needs to be held responsible for faulty equipment
My car won't turn over after i turn it off sometimes. Sometimes it will be most other times it doesn't. The battery is new, spark plugs are new, sensors are new. Starter isn't the problem. Don't know what it could be? it was stationary when this happens, when i try to turn the car back on.
While driving on a state highway, i had a number of functions stop working.the problem could come and go for a week before it happened on all ignition cycles.note, the problem could even come and go on 1 ignition cycle. The following stopped working: windshield wipers, heated seats, power windows/sunroof, power doors, power mirrors, blue tooth interface, dome lights and mirror / compass.dealer has replaced body control module and vpm.fixes seem to work for approximately 10-12 weeks before issues resurface.
This vehicle and many other year models have been having same issues and costing lots of money trying to pin point real issue. The car will turn off at stop lights, melt wires and is related to fuel pump wiring. The wire gage is to small to pull proper amps that lead to blown fuses, melted wires, car stalling and won't crank, and according to other complaints-done to gm personally by a lot of people, has quit while going down hwy. These are serious safety issues! i just bought this car from private party 3 months ago. Been having issues with motor cranking multiple times. Took it to dealership previous owner bought it from to fix jssues-seatbelt recall, new fob due to original 'dead'-it's battery still good. Check out cranking issues and doors not locking. They did not find crank issue and supposedly 4 door locking modulators were messed up. If car cranks they can't diagnose s problem. They got new fob to work. My personal mechanic had replace fuel relay, still stops cranking, just replaced the trunks fuse box. It cranks now, but for how long? gm needs to do a recall on fuel pump wiring from box to pump! put correct wire gage so this won't happen again! the last time car didn't crank was on 7/28/20. My mechanicreplaced fuse box and i have not driven it since! i have cranked it several times though. Pease help us little people get justice before it causes a wreck or takes a life! thank you.
The contact owns a 2012 chevrolet malibu. While driving various speeds, the headlights failed to illuminate and the service engine warning indicator illuminated. The vehicle was taken to an independent mechanic who diagnosed that there was an electrical failure. The vehicle was not repaired. The manufacturer was not made aware of the failure. The failure mileage was approximately 62,000.
Headlamps constantly burning out fuzes blown dangerous when lights go out at night. Safety hazard.
The contact owns a 2012 chevrolet malibu. The contact stated that while in park, the vehicle failed to start and multiple warning lights illuminated. In addition, service tire monitor, service ecs, and service traction was displayed across the message board. The failure recurred on numerous occasions. The vehicle was taken to multiple dealers and independent mechanics, where it was stated that the hvac module was draining the battery. As a result, the battery and hvac module needed to be replaced. The vehicle was not repaired. The manufacturer was notified of the failure. The failure mileage was 66,850.
My right side low beam keeps going out. I have replaced the bulb 5 times this year. I've replaced the wiring harnesses for the light bulb. I really don't understand why this keeps falling
I've been dealing with my car cutting on and off... I change my fuel pump i change the sensors and i'm stilll having problems with my car cutting off when it wants or starting when it wants. I'm now about to change my fuse box in my trunk to see if that works. The only way the car will start is if i mess with the fuse box in the trunk. Also i'm having problems with my headlights. I changed them about 3 times already but they keep going out.
Driving on the freeway @ 70 mph dry roads service esc, service traction control messages flashing alternately. Parked the vehicle next morning 20 minutes of driving again on the freeway @ 70 mph dry roads same 2 flashing messages. Park the vehicle. Started vehicle unable to move shifter from park while depressing brake pedal. Flashing message lights appear randomly as well as unable to move shifter out of park. Very frightening after parking vehicle.
My car dies when driving down the road. Electrical problem to the fuel pump
My car can run for a certain amount of time and the battery will die randomly. My headlight constantly cut off and interior my hot an cold level stay down on a reglar day. The ac blows out cold air when on heat or it will just blow air. My car will just stifen up and not drive after restarting the battery.
While parked or driving this vehicle shuts down on its own, sometimes on the freeway going 65 mph. The fuse located in the trunk has a faulty connection and a wire that isnā€™t efficient for heat from fuel pump so it shuts down while driving and sometimes wonā€™t start. This is gonna kill someone when it shuts off on the freeway in traffic. Iā€™ve read up on this being a regular problem with the malibu
I was driving(in motion) on the freeway and the esc service/traction control sensor or light pops on pushes my car into engine reduced power mode that could have caused on coming traffic to rear end me or injure me real bad this must be recalled to be fixed bad i mean asap this needs to bed revised and fixed before someone dies. Also when at stop light this happens to. Omg please im begging you all to get to the bottom of this i have small children who ride with me .
Car will start and then start shaking and making noises then dies off. Break and accelaretor locks after that
Do not remember when i brought my car in for campaign 14v252000 maybe approx. A year ago. The problems the car was having before i had the recall done have started again. Up until now haven't had any problems. My dealer wants to charge me to fix it.
I've changed my passenger side low beam headlight 3 times and it keeps going out. I've had this done 3 times since september 2020. Also, my lock and unlock buttons do not work, except for on the passenger side, only the unlock side of the button works. I've had this car since september or october i believe of 2018. It's very frustrating and i've waisted over $500 getting it replaced.
Car would not start just cranked. Had car looked at said it was my fuel pump. So i had it changed. Well the next day same thing. So i seen that the fuel pump relay was in truck replaced that as well. Well then two days later car did the same thing. Went to fuse box in trunk and opened the fuse box touched the fuel pump relay and my car started right up. I continue to do this on a daily and its also stalled at a red light and i also messed with the fuse box again and it started right up. I been seeing where people have been having trouble with the fuse box in the trunk and the wiring in the trunk. I feel i should not have to pay for this to be fixed i have only had this car for a year and a half and bought it used.
The passenger side headlight keeps going out i'm changing these out every couple months i've researched and found several other drivers are having this same issue
The rear defrost doesnt work
I have an ongoing issue in which the power steering on my 2012 malibu locks up and it's extremely hard to rotate the steering wheel to make turns....it has happened on numerous occasions from being parked from a cold start to recently actively happening while driving on the road/highway. The computer dash display pops up saying power steering then says service esc
A couple of months ago, i was driving. 10mph or lower and all of a sudden my cars esc turned itself off.i had difficulty steering it and veered off the road. Thankfully i was able to regain control. I reported it to the dealer, and when my car went in for it's 3rd recall in 2 years, they looked at it. They told me they could not get the problem to duplicate. Then today, as i was parking in ny driveway, i started rolling my windows up when i noticed they were particullary slow. I put the car in park,turned my car off, but the key back in and tried to restart it, only to hear clicking and my steering wheel to be completely locked up. Alot of indicators came on, including the cars security indicator. My car is at 66k miles, but we do routine maintenance and it has never been involved in a car accident.
My car would turn but not start so i changed the fuel pump. It was started for like 5 days then it started again would turn over but not start so we change the fuel box in the trunk. Worked for like a week and it started acting again. Took it to the chevrolet dealership and the didn't find the problem. So we took it to a technician and they told us it was a wiring problem. Paid to get it fix but it still wasn't it. Still having the problem
Car would randomly not start up. Starter would engage with key turned, but engine would not fire off and run. No codes from diagnostics. Never heard fuel pump energize with problem present. Car would eventually successfully start. Bench tested fuel pump relay with no issues. Disassembled fuse box in trunk and found the brown wire connecting the fuel pump to its relay was significantly heat stressed. The black plastic wire harness that houses the brown fuel pump wire was also stressed and deformed, and was no longer retaining the crimped connector for the brown wire. I had to clean up the metal crimp connector and pinch down on the end so that it would "grab" the relay terminal once reassembled. Car has yet to repeat the starting problem a year later.
The contact owns a 2012 chevrolet malibu. The contact received notification of nhtsa campaign id number: 14v252000 (electrical system , electronic stability control , exterior lighting , service brakes, hydraulic , vehicle speed control) and stated that the part was not available for the recall remedy. The dealer did not give a specific date for when the part would become available. The manufacturer was also contacted and could not provide an estimated date for when the contact's vehicle would receive the recall repair. The contact did not experience a failure.
I have replace my headlights about 10 within two years. Firestone have replaced the wiring, and my headlight still goes out. I'm beyond frustrated. If you go to cargurus.com, everyone is having the same problem. This is ridiculous!
My service traction control light was coming on ever since i bought my car and i took it to koons for service and i was told one wheel was moving faster then another not to worry about it then on 06/18/2014 iwas hit by a chevy silverado that ran a light and i was doing 45 miles an hour i had my granddaughter in her safety seat in the back none of my air bags worked nor did my seat belts my grand daughter hit the back of the seats.now my car is flashing the codes again now that its fixed and shuts down while driving .its part of the gm recall for the upper wire harness but they are saying it isn't and they are not standing buy the warranty this defect almost killed us and still is almost killing us by shutting down while driving service traction control lights coming on plus air bag lights saying air bags are shutting down .so that means the air bags if we needed them would not help us again if needed.we were very badly hurt the last time and i need gm to step up and reimburse us for our injuries and for making us still ride in an unsafe car that they now is on the recall list but they keep saying its not.my car is still in service and service is saying it is part of the recall bit gm will not take responsibility. ..
For no reason interior and exterior lights go on and off by itself. Neighbor reported car lights on 3:30 am. We also caught while keys were on table and locked the lights came on and off twice in the evening. This is while parked for the night.
Hard to shift out of park and the traction control disable comes on and the brakes lights will quit working and the stability control shuts off while driving down the road. I researched and i see there was a recall for all this. Recall # 14v252000 is all the same symptoms i am experiencing and i called the dealer and they said my vin is not listed. This needs to be taken care of i was almost rear ended twice due to the brake lights not working when it acts up
Cfdl7ktj tnn ynybynymbyrcrcrcrcrcryvnujycddeyhybdevgyvtu62o6afntsjtantajatnrhdhrjrmstmzvsg no rahsfjsyktasgkyskywjwyjgsntabragarhysktajtantksyjfsmysktajfantqhetqrkywktansgkywhsgnfahtwk6srjtajtsjwtjtwj51u5wjtwjtwjtwjwtnwtnwtntw
Low beam headlights have been replaced several times but now fail to operate.
Takata recall i purchased a 2012 chevy malibu 2 years ago for my graduating senior and this car has practically been a nightmare since the day we purchased it.the current mileage is 43,000 and there has been so many problems with this car. The car previously shut down while riding on the highway, our mechanic stated the car has electrical issues. Okay, so he tampered with a few wires, and the car started right up. Two days ago, the car wouldn't start, it's currently displaying "check airbag" emergency lights are flashing, wipers began going back and forward. My husband began to shake a few wires (per our mechanic) , and long behold the car has started!!!talk about buyer's remorse!!!!this car is now parked in our garage until we figure out what to do with it!!!i'm now concerned for my son's safety and will not allow him too drive the 2012 chevy malibu.
The contact owns a 2012 chevrolet malibu. While driving various speeds, the vehicle stalled without warning. The failure occurred on several occasions. The contact was able to restart the vehicle on the first attempt. On some occasions, a jump start was required. Additionally, an unknown warning indicator illuminated after the failure occurred. The vehicle was taken to the dealer, but was not diagnosed or repaired. The manufacturer was made aware of the failure. The failure mileage was 70,000.
The low beam and running lights on driver's side keep going out the wiring harness and bulb has been changed 5 times now and still goes out ever other week . And to top it off this car has the most rediculous way to get at the headlights. So time consuming
On two occassions the power steering suddenly went completely out while on the highway. Since i got the car 2 years ago i have had many issues with the lighting amd electrical.the brake light works when it chooses to even if k done push the brake and with new bulbs it may not work. The headlights do the same. They come on and go off when they choose to. I have replaced bulbs over 20 times in the past 2 years when i didn't actually have to. My sensors also don't work which i was told was an electrical issue. I have a front light that won't go off so each time i cut the car off i have to unplug my battery so it doesn't die. The date posted isnt the only date its happened it was the day it all started.
I have only had my car for 2 years.. No issues. Well maintained..recently my a/c stopped working. I was using it, turned it off , turned my car off for approximately 5 minutes started my car and the a/c would not work. Did not blow any air..it's not even lighting up when selecting different settings. It's as if the a/c control panel does not work. I have read many others complaints similar to mine, and i do not understand why the 2012 chevy malibu was not included in the 2013-2014 recall for a/c issues since this is such a reoccurring problem.
I have a 2012 chevy malibu that does not start after sitting for five minutes.no power at all in vehicle.just as soon as i put on jumper cables on,it will start with no problems. I had batt and alt tested.there is nothing wrong with those parts. What is wrong with this car.i don't need to be stuck somewhere with my (special needs)children!!!!!!!!!!!
Driving down the city road at 55 mph, i heard three bells and on the dashboard it read "service esc...service esc...traction control off" the vehicle then simultaneously began to reduce engine power and the steering wheel locked and became unlocked within seconds. This caused swerving and a near accident. I see recalls for this issue but the vin does not show an open recall for this issue.
My vehicle fail to restart vehicle, but vehicle was running good before. Once i turn off the vehicle for couple of minutes when i returned back to my vehicle and tried to turn vehicle on it would not allow me to turn on lights on vehicle would stay on when taking key out of ignition. I kept trying couple of time until i open the hood to check battery move battery cables tried again until vehicle turn on. Once vehicle had turn on and put vehicle in reverse dashboard lights started turning on check engine a service warning message display and speed meter would go up and down. When going forward the steering wheel became hard to control while vehicle would go toward slowly then stop go fast and slowly again until i got home turn vehicle off. Didn't drive it anymore until two days later. The second time i was on the freeway when my vehicles speed started to significantly reduce speed very quickly. I became concern with my safety until i was able to pull over on the side of freeway car turned off. When trying to restart vehicle would fail to turn back on had to tow vehicle back home. I tried turning vehicle back on failed at first on the last try vehicle turned on but when putting on reverse or drive vehicle became undriveable thier was no movement on vehicle and speed meter would not move . I just purchased this vehicle only had 8 months with it i payed $5000 plus $600 on plates. I do make my vehicle available for inspection it is very dangerous going through this specially on highway. I checked my onstart vehicle report but it does not show that anything is wrong on the report. My insurance provider geico car details only show it needs and oil change. I also notice that in the vehicle history shows it has an oil leak. I can not afford to pay for a mechanic at this moment my vehicle is just park at home now.
The car seems to run fine once it starts. The problem is getting it to start. Sometimes the car starts without any problems and then sometimes it won't. It has left me stranded multiple times. We replaced the fuel pump, which seemed to fix the problem for a few days and then the same thing started to happen. We replaced a couple of fuses. Again this seemed to fix the problem for a few days and then the same thing started to happen. My husband and i noticed that there is some wiring that is always hot leading from the fuse box to the fuel pump. Basically we believe that chevrolet used cheap crappy thin wiring. Because of this, the car won't start. We did some research online and it seems that everyone who owns a 2012 chevy malibu has had a similar problem that has cost consumers hundreds of dollars. We have always owned a chevy and this is the first vehicle that we have ever had a problem with. We are seriously considering switching to toyota or nissan since chevrolet has been receiving complaints and thus far has chosen not to do anything. Chevrolet manufactured the 2012 chevy malibu and was aware of the issues surrounding the fuse box, fuel pump, and the wiring. One of these days, the car is going to catch fire because of the faulty system. It is extremely frustrating to see all of these chevy malibu owners experiencing the same issue and chevrolet does nothing. We never know if the car is going to start; it's literally a guessing game. Sometimes we tap the fuse box, sometimes we kick the side of the rear passenger door, and sometimes we have to sit and wait 15 minutes and then the car will start. Chevrolet needs to have a recall and fix the issues surrounding the 2012 chevy malibu. Eventually the wiring is going to catch fire.
The contact owns a 2012 chevrolet malibu. While driving at approximately 70 mph with the cruise control engaged, the esc warning light illuminated and the vehicle slowed down. The contact pulled over and turned the ignition to the off position and back on three times before the vehicle started operating correctly. The vehicle was not taken to a dealer or diagnosed. The manufacturer was not made aware of the failure. The failure mileage was approximately 90,000.
The contact owns a 2012 chevrolet malibu. When the engine was started, the steering wheel failed to turn left or right. The power steering, esc, and traction warning indicators illuminated. The contact turned the vehicle off, restarted the engine, and the vehicle returned to normal. The dealer (southern chevrolet cadillac, 5845 coliseum blvd, alexandria, la 71303) was contacted and confirmed that the vin was not included in the recall. The vehicle was not diagnosed or repaired. The manufacturer was not contacted. The approximate failure mileage was 120,000.
Vehicle has died on me 5 times while driving.in motion one moment and dead the next, so far it has died on city streets, ive gotten lucky with it not being on the highway as i travel that frequently for work. It has been in and out of repair shop for multiple repairs and still not corrected.
The contact owns a 2012 chevrolet malibu. The contact stated the vehicle would not start without warning. The vehicle was not diagnosed or repaired. The manufacturer was not notified of the failure. The failure mileage was approximately 65,535.
2012 malibu esc warning light, traction control goes on. Brake light stays on while driving. When i stop at light or stop sign no brake light. Have almost been hit from behind at stoplight. If i stop and shut car off for a few minutes it will start without warning light. Sometimes car does not start car has stopped while moving in traffic and was barely able to coast off the road.ihave replaced fuel pump twice, fuel pump relays numerous times. Fuel pump relay is hot (overheats and stop fuel pressure. I have taken it to be serviced many times and thousands of dollars later and still not running consistently. I never know when it will start, stop while driving, or not start at all. Please recall this car.there are numerous complaints involving the same problems. I believe there is a problem with the control module as well as wiring issues related to the fuel pump. Please help me.
Head lights been repaired 3 times costing 220 each time... Seems to be no known fix for this possible electrical error....
The contact owns a 2012 chevrolet malibu. While driving approximately 55-60 mph, the vehicle stalled without warning. The contact was able to restart the vehicle approximately 20-60 minutes later. The vehicle was taken to an independent mechanic who diagnosed that there was an electrical failure and additional diagnostic testing needed to be performed. The vehicle was not repaired. Additionally, the contact stated on two separate oil change intervals, metal shavings were found in the oil filter and oil pan. Crews chevrolet (located at 8199 rivers ave, north charleston, sc 29406, (843) 820-7800) was informed of the failures. The contact stated that the failure recurred five times. The vehicle was not included in nhtsa campaign number: 14v252000 (service brakes, hydraulic, electrical system, exterior lighting, vehicle speed control, electronic stability control). The manufacturer was not contacted. The approximate failure mileage was 140,000.
My car had had the heads replaced in the first motor it came with then the whole motor replaced before 100k miles now the new motor doesnt barely have 100k miles on it and they are telling me my cylinder 6 isnt holding compression so i'll need another motor eventually! my transmission is leaking , its had a whole new air conditioning unit installed when my motor was replaced because it went out. The speakers on my passenger side dont work and my heating system on my seat on the driver side has went out!
The vehicle have nocheck engine codes but won't start and cuts off i traffic and in highway. The fuse box in trunk gets got and the fuel pump relay gets hot. After the car stalls the only way to start is shake wiretap fuse box in trunk and tap on rear fuse box
The contact owns a 2012 chevrolet malibu. The contact stated that the vehicle would not start and the security warning indicator illuminated. The vehicle was towed to the dealer where it was diagnosed that the fuel pump needed to be replaced. The vehicle was diagnosed or repaired, but the failure recurred numerous times. The manufacturer was made aware of the failure. The approximate failure mileage was 93,000.
The contact owns a 2012 chevrolet malibu. The contact stated that while driving at approximately 35 mph, the theft deterrent system warning light illuminated continuously and vehicle stalled. The failure occurred on a daily basis. The vehicle was taken to a dealer where it was diagnosed that the vehicle needed a new theft deterrent module. The vehicle was not repaired. The manufacturer was not notified of the failure. The failure mileage was 35,000.
Driver side headlamps going out.i've had to replace my driver's side headlight 3 times over the last 2 months.no automobile should go through headlamps at that rate.to complicate this issue, the entire front bumper must be removed to change the headlights.i've read on the forums where many malibu owners are having the exact same issue(s) with the headlamps.this is an obvious design flaw and gm/chevrolet should issue a recall with corrective action.
The low beam headlights on both sides of the car are constantly going out.i have to replace them 3-4 times a year.i spend hundreds of dollars onheadlamps, even though i install them myself.installing new headlamps requires you to remove the front bumper.there is an obvious design flaw with the hundreds of complaints i have seen with this same issue.
While stopped at a red light i noticed that the steering wheel would start shaking and turning on its own. Then a few days later my service esc and power steering lights started coming on and i was unable to turn the car left or right.. I would turn the car off for a few then turn it back on and it would unlock. That lasted for a few more days and then the steering wheel started locking up while i was driving. I took the car to the dealer and they said it was my power steering sensor. Its seems to be working fine now however i will never by another chevy maliibu i have had nothing but problems since i purchase this car the first issue was my light constantly kept going out. I was on the highway coming home from anout off town trip and cars were flashing there lights. I pulled over i had no back lights. I took it the dealer they said it was my battery causing my car to short circuit. It cost me $400. Then the same thing happened 20 days later the dealer wanted me to pay to have it looked at again no way. Come to find out it was a #20 fuse over the rear driver side tire wheel that kept blowing. Needles to say i know ride around with a pack of fuses in my car.. The car has 87,858 miles on it
My headlights keep going out, my car will not align and the electrical plug will not work
I have replaced my low beams 3 times this year. The first time i reaplaced all the bulbs. The second time i reaplaced both wiring harness and bulbs. A month ago i replaced the passenger bulb and now the drivers side low beam is out again. It has cost me anywhere from $100-$200 each time to do this! i also have a problem with my dash telling me service esc, esc off, and service traction. A recall in 2014 addresses this issue and my vin says the recall has been serviced but i am still having this issue. It happens with the car in park and while driving. Sometimes it stays on for hours sometimes minutes.
Cylinder 2 keep miss firingand service traction light keeps coming on. I have taken the care to 3 repair shop and spent over $2500 in repairs over the last year.
Blower motor resistor replaced 3 times in the last year. Heat has no temp adjustment stays hot. Climate control not working. Blower motor was not factory when ibought the car at 17000 mi. I think someone else had this problem before me.
I was driving 55 mph on highway and power steering went out steering wheel stiffing up and i almost went in the lane next to me./ second time i just made it to work tr=urn the steering wheel to park and it went out again./rear defrost don't work changed fuse and still wont work
The contact owns a 2012 chevrolet malibu. While driving various speeds, the traction control and check engine indicators illuminated on the instrument panel. The failure recurred numerous times. While the vehicle was idling, the esc and traction control were off. The vehicle was taken to a dealer where it was diagnosed that the valve spring failed or fractured and needed to be replaced. The vehicle was not repaired. The manufacturer was notified of the failure. The failure mileage was unknown.
The passenger side low beam light bulb socket keeps burning out. Replaced the bulb 3 times in one year. The socket is the problem, keeps shorting out. When i replace the bulb the socket where the bulb plugs in to is burnt and melted.
Takata recallwhen my vehicle started having issues it started with lagging to start i would turn the key and literally let go and then it would start. Now it's to the point where it doesn't always want to start . When it does my sensors are all messed up . First time my airbag warning was coming up . Next my sensors on my tires were not working then i started to notice when i was driving and i would stop pushing the gas the gauge will go up and down. The last thing that happened was the check engine came on but turned off. I tried to get a diagnostics done but of course nothing came of it . So now my car is just sitting in my garage until i figure it out. But there are no type of check engine light or anything that comes on before the car starts not functioning properly
The contact owns a 2012 chevrolet malibu. The contact stated that the vehicle failed to start. The vehicle was taken to a dealer and independent mechanic where the technicians diagnosed the fuel pump main circuit needed to be replaced. No repairs were made to the vehicle. The manufacturer was made aware of the failure. The failure mileage was 93,695.
A brand new vehicle with 64 miles. While driving on a rural road, the electronic stability control failure light came on and then the accelerator stopped working. After i turned the engine off, it would not come back on.this certainly could have been a safety issue had i lost control on a more traveled street.coincidentally, the only other complaint listed on nhtsa for this vehicle is for the exact same issue.
I was sold a car priced at $4,995 but when the initial contract was signed the car representative failed to keep the price the same and without consent overcharged me for the car $10,000 i called back a week later to notify them the car had went out, was in bad condition, wasn't driving, and put me and my family in harms way. Car shutoff twice in motion once while actually driving on the freeway. I asked to have it repaired due to the fact that i was forced into purchasing their warranty that he stated came with the car but put in the contract later that i would pay $1000+ dollars for it when it's an expired warranty from 2017 when the dealer first got the car so it's only a extended warranty and doesn't help with anything. He came once to repair the car by putting some fluid inside to make it run & instead told me he changed the battery which turned out to be false the car kept cutting off and going out i kept seeking help it was david and abn motorswho refused to fix any mechanical issue i was having with the vehicle and in return the car put me and my family in harms way it is a danger to have or drive with my kids cops said so also it cut off on the highway while driving and leaked an extremely large amount of oil while me and my kids were inside the vehicle i was forced to merge over completely to get out the way of traffic as the car just stopped motion. Something under the hood popped and the vehicle was smoky state officials order me and my family out the vehicle in toledo a hour drive away from my home. They stated it was a safety hazard and that i could not enter my vehicle and took it away. I had even sent over a message to the dealer representative i purchased the car from a month earlier stating i was having problems he refused to respond or help he stated that i already signed the contract and i should deal with it myself.
The contact owns a 2012 chevrolet malibu. The contact stated that after turning the vehicle off, the a/c continued to function. The failure recurred on numerous occasions. The vehicle was taken to a dealer who was unable to diagnose or repair the vehicle. The manufacturer was not notified of the failure. The failure mileage was unknown. The vin was not available.
2012 chevrolet malibu. Consumer wants to be reimbursement for repairs due to recall for vehicle. *ta
Takata recall for a chevrolet chevy malibu 2012, you cant tell how fast your going the head light electrical fuse needs replacement, driver pedals need to be replaced also.
My car wouldn't crank then it would crank. Till i was driving down the road and it just died on me going around a curve lost control of steering and brakes thank god i didn't wreck so i got in line and researched and come to find out that it was something to do with fuel pump relay connection to fuel pump relay box. The wires aware too little voltage for the fuel pump and burnt wires to fuel pump relay box. I see that there are a lot of complaints on same car as line. So i'm filing a complaint cuase this is very dangerous.
The contact owns a 2012 chevrolet malibu. While driving at approximately 45 mph, the service esc and service traction warning indicators illuminated. On one occasion, the vehicle did not shift out of the park position. The vehicle was taken to a dealer, where it was diagnosed that the brake modulator sensor needed to be replaced. The vehicle was repaired, but the failure recurred. The manufacturer was made aware of the failure and stated that the vin was not included in nhtsa campaign number: 14v252000 (electrical system, electronic stability control, exterior lighting, service brakes, hydraulic, vehicle speed control). The failure mileage was approximately 19,000.
Car suddenly failed to accelerate as i pulled on the the interstate. Car filled with a burning smell.dealer said the rear defrost malfunctioned and melted the fuse block located in the trunk damaging all wiring on the fuse block. I'm concerned that this bypassed the fuse and the relay with such a surge that it was hot enough to melt the entire fuse block. This could have led to a very serious fire where i was trapped in the car. I was fortunate to be able to pull off the interstate, but if i were in the far lane, i could have been stuck in a high speed lane resulting in injury to myself or others. The car is very low mileage and garage stored, so it is in very good condition and maintained regularly.was just in to the dealer less than 10 days prior (power steering esc recall) with no indication that there was a problem. This is a very serious safety issue.car currently at phillips chevy in frankfort, il.
2012 chevrolet malibu.consumer writes in regards to body control module system/ brake apply sensor recall notice.the consumer stated he waited for the details to restore the safety of the vehicle. However, unable to wait any longer, he was forced to sell the vehicle.
Car would turn over but not crank. Go back a little later and it crank fine. After this happening several times had someone take a look at it and there was no codes and the car would crank fine so couldn't find the problem. Then when i was out somewhere it would crank and run sluggish and go dead and after a while it would crank and run. Got to researching it and people having same problem. Said that you could wiggle fuel pump relay and it would crank. Sure enough tried this and it worked. I'm pretty sure this is same problem. And also if you had been running the car and it wouldnt crank the fuel pump relay will be hot which suggest the wiring and or fuse box is problem. People talk about replacing fuel pump , fuse box , and cheap low gauge wiring from fuel pump to fuse box. Now i'm taking to mechanic to try to get this fixed before it catches fire and someone gets hurt . Try to get fixed and buy a honda or anything except gm.
Takata recall unsafe electrical system with unpredictable headlight funtionality and unknown other results may lead to more extensive dafety issues, i.e fire concerns.
This car will not start!!!! it starts when it feels like it. Iā€™ve been stranded after work so many times for unknown reasons. Multiple mechanics have inspected car and cannot find the issue. Go on youtube and search for this year car and youā€™ll find so many people in the same situation as me. The car has battery but the engine will not start. Gm cars have this issue in common and itā€™s ridiculous gm cannot stand behind their brand. Please help us!!!
Vehicle would not start. Dealership changed fuse box and wiring in trunk due to melting. Now low beam headlights not working. Replaced one months ago, now both not working again. Noticed similar complaints on your website.
I was just arriving home and while driving i felt a change in the gears of my car but when i arrived home and place the car in park the ignition would not turn completely off and i had to leave my car on for approximately 4 hours before i left for work.
Low beams both headlights repeatedly go out. Heater/air conditioner turns off and on by itself. Motor has been changed and tested. Is there a wiring problem with this vehicle across the board. I read a lot of people with this vehicle have the exact same issues. Heater/air turns off while in park or drive randomly.
Check engine light came on. Took it too several places where they say there is an electrical shortage but they can not locate the problem.
Electrical part shuts down the car can't go sometimes you can change fuse will go and here we go again have it in and out of shop to be work on no body can't figure it out . And even shuts down when driving down roadin traffic very dangerous on highway. Had in different shops for help.getting very sick of it read other have same problem with the same type car.why isn't something being done about it ready to start buying honda cars.this has been going on all summer stillnovember. So tired of it and wasting money on it. This has happen more than one time
My passenger headlight wiring harness has a short in the wiring or from the headlight bulb to the short wiring harness to the main wiring harness. I sent general motors a message. They want me to pay for it. It is a factory fault. I only get social security for my funds.
The contact owns a 2012 chevrolet malibu. The contact received notification of nhtsa campaign numbers: 14v252000 (electrical system, electronic stability control, exterior lighting, service brakes, hydraulic, vehicle speed control) and 15v269000 (seat belts). The part to do the repair was not available. The contact stated that the manufacturer exceeded a reasonable amount of time for the recall repair. While driving at an unknown speed, the vehicle shook excessively and stalled in a parking lot. The approximate failure mileage was 60,000.
For the second time in a year the entire fuse box panel that my fuel relay plugs into has gone bad, not only does this pose a threat of fire, but also accidental injury if the car were to lose power (which it does) sporadically and intermittently without warning while driving.
I purchased this car used and 2 weeks after i had to have it towed to a mechanic from work because it wouldn't start. Mechanic said it was fuel pump so he replaced it $685 and the tow was $125. Drove it home and the next day went out to start it before work and wouldn't start but had crank. Called mechanic he had it towed back to his shop, cleaned the fuse box in the trunk and said the brown wire was loose. Started up the next day but the following day it stalled on me while me and my son was on our way to get something to eat and i hit the box in the trunk and it started. I cannot believe this is not a recall yet from how many people have went through this electrical wiring issue. This was all on city streets. How many times am i going to have to beat on this box to get it started and how long will that last? this is ridiculous!
I have a 2012 chevrolet mailbu where the key is getting stuck in the ignition. Really hard to get off of acc without jiggling gear shifter and turning wheels. This has happened three times. There is a recall already initiated but not for my year of car!
The contact owns a 2012 chevrolet malibu. The contact stated that the passenger's air bag occupant sensor had become defective and would not recognize any occupant under 130 pounds seated in the passenger's seat. The contact took the vehicle to wally edgar chevrolet service (3805 s lapeer rd, lake orion, mi 48360) where a diagnostic test was performed and the contact was provided an estimate to replace the occupant sensor. The manufacturer was not notified of the failure. The vehicle had yet to be repaired. The failure mileage was approximately 100,000.
Car will not start.son was driving and it just stalled out fortunately he was not going fast. Tried to restart but no luck. Did research and found that there are hundreds of malibu owners with this exact same issue. As a dad and a consumer i would like gm to fix this issue before someone gets hurt or killed because of this issue . We called the dealer and was told it would 400$ to fix.looks like us consumers are getting screwed again can u help?
This is my third complaint because my car has electrical issues that need repaired. The vehicle would not start, would have to tap on fuel box located in trunk to get it to start. In the middle of driving the car, the car would lose power and esc, traction control, check engine light would come on and power steering would lock up. Took it to nearest chevy dealer and they said 'the wiring is burnt up from the fuel pump/fuse box located in trunk' this is because gm used cheap wiring. My passenger headlight keeps going out, rear defrost doesn't work, and my door speakers doesn't not work. This is all because of the wiring located in the trunk. I refuse to pay over $2,000 to fix myself when this is clearly a gm issue. Everybody on here has the same problem with their malibu's. And it really sucks because i'm making payments on a car i cannot drive. This is really dangerous especially when i have my kids in the car and it just loses power and cut off in the middle of traffic.
The service engine light has been on for 3 years. Chevy has been unable to diagnose the issue despite changing out the sensors and clearing the codes. This effects the rest of the engine settings including fuel as it adjusts them based on a default. The rail support for the driver's seat has also broken loose and fallen down which makes the vehicle unsafe to drive. This seat issue was only notice earlier this year.
The contact owns a 2012 chevrolet malibu. While driving 45 mph, the vehicle stalled without warning. The contact stated that the vehicle was able to restart after several attempts. The contact stated that the failure occurred on several occasions. The vehicle was taken to the dealer (champion chevrolet chrysler dodge jeep ram, 921 south clinton street, athens, al 35611), but diagnostic testing was unable to locate a failure code. The vehicle was also test driven, but the failure was unable to be duplicated. The manufacturer was made aware of the failure. The vehicle was not repaired. The failure mileage was 110,000. Updated 9/24/18
Doors keep unlocking and locking on their own. Does it constantly no matter what i do.. The alarm doesnt do anything and the doors just keep unlocking and locking back and forth all day and night even without the keys inside while parked
Passenger side low beam headlight keep going out i have replaced bulb and socket several times ..it work only for 2 weeks and problem keep coming ..this is fifth time i'm having to fix the issues
Service esc, traction control inactive,loss of power/sluggish when driving or stopped at a light. Code 13036
The contact owns a 2012 chevrolet malibu. While driving, the headlights and windshield wipers failed to work. There were no warning indicators illuminated before or during the failure. The vehicle was taken to an independent mechanic who could not diagnosis the failure. The dealer (superior chevrolet, 4770 covington hwy, decatur, ga 30035) was contacted. The vehicle was not repaired. The manufacturer was not notified of the failure. The failure mileage was 141,000. The vin was not available.
The ecs light came on and shut my car off. The chrome dealer said there was nothing we could do about it but purchase anouther car
While on a trip the passenger air bag warning light came on while driving on highways while on vacation. This happened in may 2016 and also may 2015 while on vacation. I checked on line and it states the air bag is disabled when the learning light comes on. On line it stated back in 2004-up through 2012 they had several complaints on this, they found a problem with the wiring harness and had to do upgrade called a soft recall.i called on star and asked about recalls regarding the warning light for air bag, they said no recall on that. I requested a case be opened on 6-2-2016and have not heard anything. Why would this warning light come on for a week every may? we do severalmiles of traveling mostly less than 300 one way trips yet it has only come on in may. I called my local dealership and they said no recall on that warning light either. Previously i had a 2009 malibu which i purchased mainly because of the safety of all the airbags. If i or may passenger is in danger at any time with the airbag disabled it's not safe, period.
In 2019, my vehicle's tail lights, blinkers, headlights, & interior lights went out. I began to receive dashboard notifications from my car about traction control in early 2018 and earlier this year i started receiving notifications of problems with my airbags. I bought new bulbs, but that didn't solve my lighting problems. I took my car to a chevy dealership and was charged/paid a large sum of money to be told i needed a new fuse panel and headlight bulbs. I was told the panel wasn't available due to a strike at the plant & to come back later to have the panel installed. I returned later to be told that the tech didn't record his findings on my profile so no one knew what was wrong with my vehicle and was asked to pay out more money. Therefore, i took my vehicle to a different dealership and it was documented that my vehicle required a substantial amount of wiring which includes, but not limited to, body control module (bcm), body harness, a new fuse block, labor, etc., the price tag is in the thousands. I conducted online research and learned of recalls on my vehicle. I contacted chevrolet and was told there was no recall on my particular vin although there is a recall on the year, make and model of my car and there was nothing chevrolet could do to assist me. However, for every single issue i am experiencing with my car there is a recall for it. I am unable to drive my financed vehicle due to safety hazards and the possibility of being ticketed by the police or worse.i received notice for one recall after purchasing my car and that was for a seat belt. From my understanding 13036 is the bcm chevy recall number. Please let me know if more information is needed.
Takata recallwhen i'm driving my vehicle, the headlights flicker as if i'm the police. I took it to firestone and they told me to take it to a dealer the car only has 160,000+ and it just startedevery time i accelerate or drive it does this and i'm afraid that i will either get pulled over by the police, hit someone or someone hits me or/and the lights go completely out while driving at night. Is this due because whenever you have to change the build, the whole bumper has to come off to replace it? i like my car but this is a serious issue that needs to be addressed. I see a lot of complaints regarding this
We purchased a 2012 chevrolet malibu sept. 2014 and it has been serviced 3 x due to the power steering locking up while driving and failure to start several times.the car would chime and the gauges would all drop to 0 and the engine light, power steering, low fuel and anti-theft light would all light up making the vehicle very difficult to maneuver.
The contact owns a 2012 chevrolet malibu. The contact stated that the vehicle would not start and the air bag and check engine warning indicators illuminated. The contact stated that the failures occurred on different occasions. The vehicle was taken to cox chevrolet (2900 cortez rd w, bradenton, fl 34207,(941) 348-6417), but the cause of the failures could not be determined. The contact stated that the dealer made unknown repairs to the vehicle, but the warning indicators remained illuminated. The contact also mentioned that the vehicle was taken to a local tire shop for the replacement of the exterior lighting. The contact stated that every three months a different exterior light would go out and had to be replaced. The vehicle was not repaired. The manufacturer was made aware of the failures. The failure mileage was unknown.
Driving on the [xxx] . A large piece of debris from a suspected truck flew and damaged my vehicle. The truck did not stop so i'm not sure if it actually came from it. The insurance company denied the claim because the debris would be considered collision not comprehension (i am covered for comprehension). Now i am stuck with fees that i am not even liable for.
Both headlights will not come on (low beam) high beams work fine. Bulbs are new and fuses are working just fine..someone needs to put in a recall because i see i am not the only one with this issue..this is ridiculous! can't drive without headlights and can't drive with high beams on
Driving my vehicle with my 3 month old daughter in the car. Turned the wheel as i was taking a turn and the power steering completely stopped. This forced me to apply the brake because i almost wemt off the road!! i see this isn't the only incident involving the esc and power steering!! vehicle currently has "service esc" and "power steering" messages displayed in the info messages.
I have a 2012 chevy malibu lt and my car has the same problem as everybody else's. It would cut off and lose power while driving and at first i would beat the fuse box in the trunk and it would run. Now it doesn't even work at all. Had it diagnosed at my local chevy dealer and they said the wiring leading from the fuel pump and fuel box is all burnt up. I refuse to pay $2000 or more to fix when this is clearly a gm issues. It needs a recall on this vehicle because they used cheap wiring. This is my second complaint and i will continue to write complains until it is fixed. Esc, power steering would lock up which makes it very dangerous especially with kids in the vehicle.
The contact owns a 2012 chevrolet malibu. On several occasions, the vehicle would not start. Also, while driving approximately 55 mph, the vehicle stalled without warning. The vehicle did not restart. The vehicle was towed to the dealer where it was diagnosed that the fuel pump needed to be replaced. The fuel pump was replaced on two occasions; however, the failure recurred. The manufacturer was made aware of the failure. The approximate failure mileage was 23,700.
When i get in my car i notice that my check engine light comes on in an are where certain people don't like me at like cuba mo there is a conspiracy going on out here ever sense they took my kids illegally it's been nothing but problems and i don't want to get hurt or hurt nobody please help my gas leaves quick also i know my car is being hacked because they do that a lot out there and surrounding cities theengine light will come on while i'm driving and when i'm out the car it'll come on there is also a tracking device on it that i didn't put on there also i put gas in my car then all of a sudden it goes down to low fuel i just bought the car from the dealership at jd by rider in rolla mo*dt
While in motion more than two dozen times on city streets, on busy highways and while turning in a busy intersection with children in the car. 2012 chevy malibu stops while in motion on the above stated streets, highways and intersections. Read where someone beat on the rear fuse box then car starts so i tried it and it works for a little while but doesnt solve said problem. Checked battery. Battery is good. Check engine light and esc light stays on. Esc light only goes off at high mph. Have to let car sit for awhile to start before knew about fuse box trick. Someone that tried to help me get off middle of busy street said it sounds like a fuel delivery problem.
Headlight keeps going out
I have a 2012 chevy malibu i bought it in 2014. I have had the esc light come on in 2016 but no problem with it untill now of this year in 2022. Not knowing the problem i have already put alot into it. I took it to a machanic they told me it was the rack and pinion. So got that done . Apparently it wasn't it took it to another machanic they told me it was struts got that done too n still nothing so i looked it up online got cv joint, inner ,tie rod, wheel alignment. All those done n still nothing fix it. I didn't know what else to do until i made more scratch on my vehicle and i found that it could be a recall .
Constantly having issues with the electical system in this vehicle, and from further studies and investication via internet complaints and youtube customers/owners...this is a continual ongoing problem for a substaintial amount of chevy malibu owners from the year of 2009 to 2013/2014 models. There should be a recall asap on these make and models. The issue is that the headlights constanly short out and blow out. Mechanics and service has found that the electtical connectors for hllightbulb overheats, melts the wiring, and burns out bulb> this is very dangerouse and is a fire hazard. This has happened at least three times on my vehicle alone. Also constat problems with rear right wheel convertor speed and tire sensors, and the entire electrical system over all. The wiring in this make and model vehicle constantly have blow out fuses, the emergency light indicators always coming on, and the sensors on and off. This is a well noted and documented occurans with these vehicles. These cars need to be recalled due to danger with possible fire and car stalling out while driving due to electrical issues and heating/cooling ac wires shorting out. In all overview this has caused me severe finacil problems due to constant repairs and part replacement. It is a danger to myself and others on the highways and roads. I need this to be addressed immediately. I have some of the meltedfire sparked parts.please contact me as soon as possible. Many days i dont have needed transportation due to these issues and i get repairs all of the time while still paying a car note. I am scared to keep driving thius car.
After owning the car only 3 weeks, the circuit board blew a wire connector causing my fuel pump to go out after the dealership just had these exact parts replaced himself at time of purchase. The car has lost power, has issues with blinker sticking or relay. The car drains rapidly when a.c. Is turned on. Radio sometimes shuts off sound. The vehicle has cost me over 3000 within my 3 months of ownership has only 140000 miles on engine. Electrical issues everywhere am fearful it may catch fire while driving down the road with my 3 children! youtube has many complaints on same make model vehicle with same occurring issue's! luckily when circuit board blew a compactor the vehicle was stationary in the parking lot at dollar general. We were forced to have it towed to destination.
While driving to school going roughly from idle to 10mph as started to get on the highway the esc services power steering light came on and i lost all power steering. Needless to say me being 5'3" and 98 pounds didn't help me much to control the vehicle.i slowly pulled over to the side of the road and gathered myself not knowing what just happened. I turned off the car and gathered my thoughts. Luckily i was on straight away with no turns when this happened.so i preceeded to turn the car on and noticed the message was gone so i checked the steering and the problem light was gone.well with that said, that was the first this had happened. And now it has progressed during the winter. I don't know if the cold has anything to do with it. But this is scary and gm should try to address it. I believe there was a recall for this issue but my vin doesn't show that recall. Can you please help. The problem is starting to happen when i start my car now.
At approximately 45,000-50,000 miles "service airbag" light would come on intermittently. Took into dealer, not covered by extended warranty because the seats were involved with the issue on some level.gm would not pay for the repair though the car was less than 2 years old.dealer did something and light stopped coming on.now at 85,000-90,000 miles the light is back on for days at a time. The light always comes on upon starting the vehicle.
Takata recall. While on the highway going 60 mph i lost all power to my vehicle almost causing a few accidents. I pulled the car over and had it towed to a shop. They had to push the car into the shop due to it not starting. After throughly looking and checking everything the dianosic test did not revel anything. The mechanic then banged on the rear fuse panel (trunk) the car then started. The panal is shuting my fuel pump off. The fuel pump has been tested the fuse relays have been tested. The problem is faulty fuse box and wires connected im assuming. After 2 weeks and 3 mechcanics my car is still not running.
Low beams are to low for night time driving can they be adjusted? can't see very far so have to usebrights very dangerous for oncoming traffic also.also the interior lights, instrument lights, get real dim either driving or stopped, so dim gauges are hard to read. After a while they come back on.
I was sitting in parking lot with car in off state listening to radio when it was time to leave my dash lights flickered, symbols went in/out, car wouldn't start. Had to tow home
1)air bag service light came on.12062018 (2) windows/electric constant problems. Several repair and correction same problem. )1st team mazda hpt va) window sticks, freezes, doesn't work. (3) drives bumpy. Sounds rough. Ran smooth before then several repeated same problems with car. (see maintainability. Log)(3) drive felt awkward. Had new tires, rotation etc. Drive is off. (4) can feel rough run while stationary, drive is not as smooth. (5) 1 recent incident. Parking lot female drive alongdrivers side front bumper. Repair 1st team mazda hpt va. 23666
Vehicle is stalling out while driving, then when shuts off it will not start back up. Fuel pump was replaced, worked great for 1 whole day then did the same thing, left me stranded. Fuse box was then replaced. Ran great again until recently it stalled out in the middle of a very busy street causing me to almost be hit. Pins in the fuse box were replaced, but i'm still having issues, it seems to be related to the fusebox wiring itself, because i'm also having problems with things ran off of that fuse box! this getting ridiculous i've only had this car 4 months and it's been the worst car yet i've never had a vehicle leave me stranded. It needs to be recalled
The contact owns a 2012 chevrolet malibu. The contact stated that the vehicle would shut off at any given moment. Sometimes the vehicle would immediately restart and other times the contact would have to wait several hours before restarting the vehicle. The contact took the vehicle to the dealer three times, but the cause of the failure could not be diagnosed. After the last failure occurred, the vehicle could not be restarted. The vehicle was not operable. The manufacturer was made aware of the failure and a few cases were opened regarding the failure. The vin was unknown. The approximate failure mileage was 61,000.
Driver side headlight kept going in and out until completely going out and not working. When getting a new bulb put it it did the same thing a week later. The wiring in the headlight is faulty. The same thing goes for the front speakers of the car. The front speakers will come on and off on their own as well.
Intermittent starting issues on this vehicle.will randomly turn over but not start.if we let it sit for a couple of days it will then start, but leaves us stranded.this happens every 2-3 months.lights start blinking randomly as driving, traction control will turn on as we are driving causing reduction in power.there are numerous complaints online about this issue.
Three times in two months the passenger low beam has gone out. I work nights and each time it has gone out it has been while i am driving to work in the dark. I have researched the issue and no clear answer has been given on how to fix the issue.
In 8/25/2014 it started when my wife want to start the car and it didn't just cranks but wont started, it did after a few tries, and then happened again the same day to my son and after a little while it started right back, and that same week i was driving about 30 miles per hr.and all of sudden it just died with no codes or check engine light displayed,it is too dangerous that happen in the middle of a main road because it didn't want to re start i have to push it across of the roadwith all this cars behind you and be afraid of being hit.it seems that it been more and more frequently happening this weekand takes longer wait to re start it, i just want to know if is a defect of this malibu 2012 i. I heard that malibu's have a issue with the antitheft system. We scanned computer history and it shows antithefthistory stored on it. Am afraid of go into expressway and run into an accident. Please help my car is a 2012 impala with 65000 miles on it.
The anti-theft system randomly activates and shuts down the car. It prevents me from starting the car. It usually happens when i am trying to start the car but i've read posts about it happening while people are driving.
While driving my 2012 chevy malibu on a highway, the car suddenly turned off in motion.i then looked to the rear of the car while trying to maneuver the car to the side of the road and noticed the entire rear of the car engulfed in flames.when the car came to a stop i was able to jump out and run for some aid.i was able to put the fire out with a fire extinguisher before the the police and fire departments arrived.upon investigation, it was concluded that the fire was cause by a faulty fuse box located in the drivers side of the trunk.the car is totaled.
This is my second incident report for the same vehicle. While driving on the highway the vehicle suddenly lost all mobility. No warning at all just stopped running. Fortunatly i was not at a very high rate of speed but was getting ready to make a turn off the highway. No indication that anything was wrong at all. My concern is why does someone need to get hurt or killed before this prolem is addressed? having taken this to be serviced i encountered others who have had the same experience with their vehicles, all chevrolets of one model or similar to it. Basically the same motor. This happened to me before and i have not been given a reason for the problem.
I was driving on the interstate and my car went into reduced power and shaking violently. I was almost hit from the back by a semi.
Started out when i'm just driving down the road my steering wheel twitches.now has gone to esc power steering warning indicated and the steering wheel completely locks up.most of the time just when i start the car however has done it when i'm driving down the road.thankfully it was a secluded road and i didn't hit anyone.this is super dangerous and according to my search of the internet i'm not alone.
Car will shut down. Head lights stop working less then every two months. Fuse inside the car where to charge the phone isn't working both front and middle. Car dies randomly after being left on for a little while. Hot and cold rate stays on cold all day and has the ac unit blow out cold air when on heat and if on cold it just blows air. Car wont drive faster then 5 mph after having the batery rebooted depending on if te car was allowed to sit idol or a while. Car will place it's self in shut down de to elecrical problems. Once one starts acting up they all start acting up.
Passenger head light has been replaced several times it keeps turning off. Light bulb is not burned. When taping on or moving wires light goes on replaced wires and still having same issue. Vehicle can not be driven at night time. All this happens when vehicle is turned on.
The contact owns a 2012 chevrolet malibu. The contact stated that the vehicle experienced a complete loss of power while being operated at various speeds. The failure occurred without warning. The vehicle was taken to the dealer, but the failure could not be replicated. The manufacturer was notified of the failure. The failure mileage was approximately 56,332.
Got the car few months ago , car one day wouldn't start couldn't figure out finally figured it out, the fuse box in my truck i can hit it and then my car started just fine it happens alot to where i gotta hit the fuse box in my truck to get my car started thought it was the crank sensor but nope it has something to do with the fuse box in the truck & also heard it's the fuel pump relay.
The blower motor resistance converter had gone out and it was determined by a mechanic that the wiring was burnt to a point that it could have caused the car to catch fire.i was also advised by the mechanic that there had been a recall for this specific problem but my vehicle identification number was not a part of the recall.this is unacceptable practice by general motors as my life and the life of my family was in danger. Updated 10/07/15*lj
Since september of 2014, the low beam headlights on my malibu have repeatedly gone out. The latest two incidents in march 2015 (passenger side) and june 2015 (drivers side) have resulted in the socket burning out. There is a forum where many drivers have noted this same issue. I was told it sounds like there is an electrical issue with the harness and that it is a very serious issue and could lead to a very bad situation. I've called and complained to chevy but they claim that they have no prior complaints which i find hard to believe. This is a very expensive issue because of how they have constructed the vehicle. Please force them to fix this issue.
Was driving and my car stopped accelerating. I pushed on the gas and it would not go. I was on the free way and almost had an accident. Also car would no longer start after stopped. Would act like it was going to start and does not. I've had several toes with my children in the vehicle. A huge safety concern.
My low beam headlights will not work. I have changed bulbs only to find out it wasnt the bulbs...they still work. I have changed one of the pigtails and it worked for a while and stopped within a month. It started with only the right headlight and now it is both.
For the past 2 weeks , i had a problem with my car starting. I would drive to work fine but when i would leave from work my car wouldn't start. Initially, i thought it was the battery so ihad it jumped. I immediately took it to autozone to have the battery tested. I was told the battery was in excellent condition. My father advised to put heet fuel injector cleaner as it was extremely cold and he thought maybe water got into the fuel line. Well that same day after stopping to pick up my child for 5 minutes i shut the car off. It wouldn't start. I called the tow company but after waiting on hold 20 minutes later i start my car at the direction of the roadside assistance tech. It started. Then it happened again a couple of days later but i let it sit and tried it again. Car ran fine for a week then as i was leaving for lunch today it wouldn't start. I had it towed to the dealer for diagnostic testing. Come to find out that the fuel wires melted onto the fuel box and they had no idea why. This sounds like a serious matter because i wonder what would've happened had i continue driving with melted wires on the fuel box. Sounds like a fire waiting to happen.i felt that this is some type of defect because that isn't normal wear and tear.
The contact owns a 2012 chevrolet malibu. The contact stated while driving 35 mph, the vehicle stalled without warning, the vehicle was unable to be restarted. The contact stated that the service esc warning light was illuminated. The vehicle was taken to suburban chevrolet cadillac collision of ann arbor (3515 jackson rd ste b, ann arbor, mi 48103, (734) 663-3321) where it was diagnosed with needing battery, and negative battery terminal to be replaced. The vehicle was repaired however, the failure persisted. The manufacturer was not informed of the failure. The failure mileage was approximately 66,017.*dtthe consumer stated the vehicle would slow down with a loss of power steering and electrical issues and sputtering engine. The throttle body was replaced twice and was recommended to be replacedthird time.
Low beam on passenger side goes out frequently and randomly. I thought it was just my luck. However according to https://www.cargurus.com/cars/discussion-t32066_ds667897 there are a lot of people with the same issue. Ive been lucky enough to keep getting stop by nice cops, but this is getting bad. I have a 1year old that i cant take out in the car because it isnt safe. For who knows what reason. Please help.
My chevy malibu would turn over slightly, but then would die.this happened about 3-4 times and then i had the battery replaced; thinking it was that.the car continued to fail, so i had the fuel pump replaced after checking with a fuel gauge and there being no fuel pressure.the car ran about 3 times driving it for shorter and a bit longer distances, but then the car would not turn over at all.the starter would try, but there was no ignition of the car.at my local chevy dealer, don mccue, they diagnosed that the rear fuse box and a few terminals were burnt out.they replaced the rear fuse box and a few terminals, and the car now runs successfully.
I was driving to work one morning going about 30mph and car just lost all power , could not steer the car, pulled off road, waited about 20 minutes and car started back with no problems, then a few days ago went out to start car and would not start, the instrument panel would light up but would not start, had to have in jumped off, took it to auto place to have battery checked, battery was fine, drove it home, drove it the next morning to work with no problems, then that afternoon, would not start again, had to have it jumped off again, took it to auto place again, and battery ok, allternator ok , i have read several reviews on this car and all seem to have the same problems, have not took it to mechanic yet, but afraid to drive it
Driver side headlight malfunctioning multiple times in past year. Head light will go out, at first could tap on head light and it would come back on. Have changed pigtail and bulbs only to have it work for a short period of time.
The contact owned a 2012 chevrolet malibu. The contact stated that while his wife was driving at 10 mph, other drivers alerted her that there was a fire underneath the vehicle. The contact's wife was able to safely exit the vehicle. There was no injury and no medical attention was necessary. The fire department was able to extinguish the fire. The contact's wife was informed that there might have been an electrical short that caused the fire. A fire department report was filed. The vehicle was towed to the residence. The contact left a voicemail for the dealer notifying them of the failure and was awaiting a callback from the dealer. The manufacturer was not made aware of the failure. The failure mileage was 112,000.
Without warning the cluster of gauges start going crazy and all warning lights are illuminated on the dashboard. The vehicle loses power steering and vehicle speed will not exceed 20mph.eventually the vehicle stalls out.
Low beam headlight going out. I purchased this vehicle in 2014 and my low beam headlights have gone out a total of 6 times.changed the pigtails last time and iam now having to change the wiring harness completely and hopefully that will help. My cars lights are always on auto and always begins with my passanger low beam light going out first then the driver side a couple months after, has happened when turning on the vehicle and during driving.my high beams work fine with no problems at all.the first two times i have had a proffesional mechanic change them and the last couple times i've changed them myself now due to cost.removing the whole bumper really makes this even more difficult to change.i have read many forums and they have also the same problem, its actually become very common to see many chevy's with a head light out.i just want to make sure this is noted cause it appears to be a common problem with this vehicle company. Please help!
While driving at 25 mph on main street in florida,ny the car suddenly stalled & the electrical system shorted out.
While in motion car jerks and almost stalls. Rough idle again jerking and almost stalling. Serviceesc / service traction /engine light come on.if car is not used for a few days, warning light will not come on. Then about 30 miles into drive lights come on and condition described above occur. This is a very dangerous condition.
Early october 2014 i begin to smell a burning plastic smell after car is stopped. Self inspection found nothing, mechanic inspection found nothing. Around january i took car in for brake light recall, had service tech inspect; said they found a melted bag on exhaust (i saw no such thing). Late january 2015 my car won't start after sitting all night, car was jumped and started fine. Late march 2015 passenger side headlight sometimes fails to turn on at first attempt and after a 2 hour drive, next morning car won't start; after waiting 20 minutes car starts. 4/4/2015 car is left on (engine off) with radio playing while cleaning out car, after 10 min service esc comes on dash, i immediately turn off car. I try to start engine, no ignition. The car wouldn't even try to turn over. I took car to autozone where they tested the battery and the alternator where both were found to be in perfect working order. I can hear the fuel pump attempt to engage and if the battery and the alternator are fine then that leaves me to believe it is the starter...however, if the smell wasn't a plastic bag but instead a wire melting, then i would have a short which could also be causing this. Bought this care as a safe mode of transportation for my son and i, i find myself more stressed out wondering if i will be able to get us were i need to go than with the old car i use to have. If this turns out to be a malfunction i hope gm is willing to make it right. The problem is increasing and no one has yet been able to figure it out.
The contact owns a 2012 chevrolet malibu. While driving at an unknown speed, the vehicle began to decelerate. Approximately five seconds later, the engine lost power without warning. The vehicle was taken to an independent mechanic where the failure could not be diagnosed or repaired. The failure recurred and the brakes failed to function properly. The vehicle was taken to another independent mechanic and a dealer, but they could not diagnose the failure. The vehicle was not repaired. The vehicle lost engine power, but the headlights and air conditioning still functioned. The manufacturer was made aware of the failures. The failure mileage was approximately 110,000.
The headlights have continuously shorted out. I have changed the headlights 3 times in a 3 week span and they keep going out. I have replaced fuses as well. The traction on the car is constantly slowing down. The esc light comes on. The car slows down on all streets and it has done so on the highway.
Driving and both low and high beams go out at night. Days later it came back on, then a day later went out again.replaced lights bulbs and a week later it goes out again! this is dangerous and clearly a safety issue! i almost crash the first time they went out on the freeway.
Headlamp harness keeps burning causing headlamp to fail to illuminate.have replaced multiple bulbs as well as both harnesses within the last 6 months and again, harness has burnt and my low beam headlamps do not work.reading similar complaints, i believe it has to do with the daytime running light feature.i've noticed the issue both when the vehicle is moving and when it's stationary.while there hasn't been a fire as a result of this issue yet, i'm sure it's just a matter of time.
Several systems have been affected.the systems affected are the radio controls on the steering wheel, the power steering, the traction control and the rear defrost.there seems to be a short that goes from system to system.modern chevrolet in winston salem, nc said it was a short in wires on the steering column that was causing this.there are three recalls that would deal with this.the recalls are for steering, traction control and finally wiring.both modern chevrolet and chevrolet corporate have said my vehicle is not covered due to the vin #.i do not see where that matters.if a part is bad then all vehicles that part is used on should be covered no matter what.the steering was the most affected.the power steering would go out and it was very difficult to steer the car.this happened on several different occasions.
The passenger low beam keeps going out its not the bulb i've changed it atleast 4 unless this year yet it stills goes out and everybody else has the same problem on same side of the same car. There needs to be a recall for this.
Tl- the contact owns a 2012 chevrolet malibu. The contact stated that the air pressure sensor illuminated multiple times intermittently. The authorized dealer reset the code and the failure recurred. The contact had difficulty activating the cruise control and had to make multiple attempts to get it to work. Also, the battery had drained intermittently and the window wipers had to be replaced. The manufacturer was notified of the failure. The approximate failure mileage was 5. Pam
In less then one year the passenger side low beam light is out. I look on line and a lot of 2012 malibu are having the same problem. It cost over $100 to change it because they have to remove the bumper to do it.
Timingchain causing car to misfire and engine light on
Was operating the vehicle on the interstate when i was forced to brake and hit the horn to avoid a collision. The "service airbag" light came on and stayed on. I found that by hitting the steering wheel it would go out and reset. Every time i use my horn causes the "service airbag" light to come on. Sometimes it goes out again on its own. Unsure if the airbag would deploy while the light is on.
My car is not working the steering wheel and brake
Vehicle (2012 malibu) was purchased april 2012 - starting july 2012 vehicle would stall going down the road, with loss of engine, power assist steering and power assist brakes. Dealer replaced numerous modules, but it occurred again in sept 2012 (3 times) then again in january 2013. Two body control modules have been replaced, engine control modules, two power steering modules, onstar module, transmission control module, etc. Unintended power steering assist occurs such that within approximately 5 seconds while driving down the road, power steering comes in and out as module fails (along with engine and transmission). Very unsafe to drive. Dealer would not replace vehicle and gm states they stand by last repair. It has been repaired 6 times now, but we refuse to drive vehicle, as we believe there must be a short somewhere. They keep stating it is defective modules and they just keep replacing them. Please see youtube videos: "2012 chevy malibu - unintended power steering assist failure mode?""2012 chevy malibu dangerous electrical problem - any ideas?"
Service air bag light on all the time car was in park when it first appear
2012 chevrolet malibu. Consumer writes in regards to multiple safety defects with vehicle. *ldthe consumer stated the vehicle has several safety defects including the electric stability control, brakes, sensor lights, steering, suspension, wheels, engine lights, power train. Updated 10/23/2017
The contact owns a 2012 chevrolet malibu. The contact stated that the vehicle was not operable. The vehicle was towed to an independent mechanic were it was diagnosed that the wiring harness and fuel pump were defective and needed to be replaced. The vehicle was repaired; however, the vehicle was still not operable. The vehicle was re-inspected by the independent mechanic where it was diagnosed that the fuse box and relays were defective and needed to be replaced. The vehicle was repaired. Gusweiler gm center (1132 state rte 41, washington court house, oh) where it was confirmed that the fuse box was faulty. The manufacturer was notified and did not assist. The vin was invalid. The failure mileage was approximately 46,000.
Driving into town, alerted by pedestrian that my car was on fire underneath. Everything failed, while i tried to pull off the roadway. Had to kick out the window to get out. When i barely got out, the entire car was in full blaze.
This is the second time i am reporting this car and will continue to do so until something is done about it! i have put thousands of dollars into this car all for the same problem, as has many others. There are starting and stopping issues related to the wiring for the fuel pump. Just go on any gm forum and you will see hundreds of complaints related to this problem.why must you wait until someone dies due to this. Stopping while driving is extremely dangerous. I have kept all records of repairs and complaints all related to this problem and should anything happen to me while driving this car my family will be prepared to bring forth lawsuits. How much money do you receive from gm to not act on this problem. Your form asks for a date this happened. This has been an ongoing problem for years.
I have all the same issues as recall number 13036. Recall id 204828, 204826 and 2 more. Sometimes break light wont work when needed and comes on when not being pressed. Also a front blinker light stays illuminated unless i unhook the battery. Just undoing the light doesnt work. Also my roght blinker doesnt work. Some wires in my fuse box look melted. Ive report this before
The contact owns a 2012 chevrolet malibu. The contact stated that the speedometer was faulty and would not display the correct data. Pat o'brien chevrolet (3880 pearl rd, medina, oh 44256, (330) 460-0718) diagnosed that the instrument panel cluster needed to be repaired. The vehicle was not repaired. The manufacturer was made aware of the failure and did not assist. The failure mileage was 77,100.
The contact owns a 2012 chevrolet malibu. The contact stated that the key failed to start the vehicle. The vehicle was inspected by an independent locksmith who diagnosed that there was a metal piece inside the ignition causing the failure. The manufacturer was not notified of the failure. The approximate failure mileage was 60,000.
The contact owns a 2012 chevrolet malibu. The contact stated that the vehicle failed to start. There were no warning indicators illuminated. The battery was jumpstarted by the contact. The vehicle was taken to james corlew chevrolet (722 college st, clarksville, tn 37040, (931) 552-2020) where it was diagnosed that the anti-theft system needed to be reset. The vehicle was repaired. The manufacturer was not contacted. The failure mileage was 180,000.
The contact owns a 2012 chevrolet malibu. While driving 40 mph, the vehicle stalled. The contact was able to restart the vehicle after some time. In addition, the vehicle failed to start intermittently. The air bag and anti theft warning lights illuminated. The failure recurred on numerous occasions. The vehicle was not diagnosed or repaired. The manufacturer was not notified of the failure. The failure mileage was 95,261. The vin was unavailable.
The contact owns a 2012 chevrolet malibu. The contact stated that smoke entered the vehicle near the front of the dashboard. The contact inspected the area and noticed that the failure was not coming from the area of the engine, but rather there was a strong odor of burning wires. The dealer was not contacted for diagnostic testing or repairs. The manufacturer was notified of the failure and advised the contact to schedule an appointment with ourisman chevrolet of bowie (16610 governor bridge rd, bowie, md 20716, (301) 262-7600) for diagnostic testing. The approximate failure mileage was 110,000.
The contact owns a 2012 chevrolet malibu. While operating the vehicle, the low beam headlights suddenly shut off. The vehicle was taken to an independent mechanic who diagnosed that the wiring harness melted. The failure occurred on both the driver and passenger sides. The manufacturer was notified of the failure. The failure mileage was 90,000.
The contact owns a 2012 chevrolet malibu. The contact stated that the vehicle's low beam headlamps failed to operate. Jeff wyler springfield chevrolet (2237 w first street, springfield, oh) diagnosed that the wiring harness had melted and recommended it be replaced. The vehicle was not repaired. The manufacturer was notified and did not assist. The failure mileage was 93,000.
At 1st my car wouldn't crank every so often then started going drag while driving i googled it and had to beat on fusebox in trunk or wiggle wires so had to run wire straight to battery to fuel pump. My headlights on dim keep shooting and my speakers will go out sometimes
The lights randomly come on then the antilock brake system will start to act up when i go to stop as if i was to slide on ice but i'm not i'm on dry pavement. On city street.
The contact owns a 2012 chevrolet malibu. The contact stated that while driving at various speeds, the service electronic stability traction control warning light flashed as the vehicles speed reduced. The failure recurred multiple times. The vehicle was not diagnosed or repaired. The vehicle was parked at the contacts residence. The vehicle was also included in nhtsa campaign number: 15v269000 (seat belts) but the part was not available and did not indicate a time frame that the parts would become available. The manufacturer was notified of the failure. The failure mileage was not available. Parts distribution disconnect.
When i get in my car i notice that my check engine light comes on in an are where certain people don't like me at like cuba mo there is a conspiracy going on out here ever sense they took my kids illegally it's been nothing but problems and i don't want to get hurt or hurt nobody please help my gas leaves quick also i know my car is being hacked because they do that a lot out there and surrounding cities theengine light will come on while i'm driving and when i'm out the car it'll come on there is also a tracking device on it that i didn't put on there also i put gas in my car then all of a sudden it goes down to low fuel i just bought the car from the dealership at jd by rider in rolla mo*dt
Takata recall it constantly shakes and my car is constantly pulling and random codes pop up all the time .not to mention it's a 2012 and it's rusting majorly. I am driving when my car seems to be missing a beat it wants to jerk on me like it wants to stop running. I was on a city street it happens a lot .
I'm having problem with brake pedal sensor -replaced twice already - while drivinghit brakes error message service abs service traction cruise control want disengage also noticed that i could move the gear out of park with out pushing the brake pedal are there any recalls for these issues?
Driving on the freeway @ 70 mph dry roads service esc, service traction control messages flashing alternately. Parked the vehicle next morning 20 minutes of driving again on the freeway @ 70 mph dry roads same 2 flashing messages. Park the vehicle. Started vehicle unable to move shifter from park while depressing brake pedal. Flashing message lights appear randomly as well as unable to move shifter out of park. Very frightening after parking vehicle.
When i started mycar this morning, it was rumbling and sounded very loud,when i got in the car the service engine and traction lights were both on.the message read to service esc.it also stated that i had reduced engine power.i drove to work (3.5 miles).the car crawled along finally being able to get up to 40 mph.i had to stop at a major intersection where 2 highways intersect.while stopped, my car lunged out into the center of traffic.this is not acceptable and was a frightening experience.thank god i didn't have my 2 sons with me.once i arrived at work, my car wanted to again lunge forward as i tried to park it. I've read online where many chevrolet owners with cars the same age and similar miles are having the same issue.i only have 45,000 miles on the car.i'd like to know why there isn't a recall on this very serious and potentially deadly issue.there are several semi trucks that are traveling the highway i had to cross this morning.gm is lucky this isn't one of my family members reporting a deadly incident to the media.this must be addressed by gm before there are casualties and life lost.i will be awaiting a prompt response.
Randomly doesn't what to start been to shop several times mechanicgoes to fuse box and mess with wiring and starts upi go through this problem several times for months now. Tired not having a car to get to work mechanic can't figure out why it dong this need recall on it several complaints i read about already same as me. Also one time act like was going to stop downtown in traffic pull off side road call ed mechanic.
Electrical part shuts down the car can't go sometimes you can change fuse will go and here we go again have it in and out of shop to be work on no body can't figure it out . And even shuts down when driving down roadin traffic very dangerous on highway. Had in different shops for help.getting very sick of it read other have same problem with the same type car.why isn't something being done about it ready to start buying honda cars.this has been going on all summer stillnovember. So tired of it and wasting money on it. This has happen more than one time
"service esc" light illuminates when making sharp turns, slowing down on the interstate, as well as breaking in bad weather. After replacing brakes twice and rotors once i scontinue to experience this problem . After a recent inquiry i learned of a recall on "service esc" as well as "traction control".
Driving approximately 30 mph down the road my steering stiffened and i heard a chime and service esc across the dash warning system, i could not turn the wheel. The electronic steering control was not working and i had to try to manually steer. I had my 1 yr old and 4 yr old in my vehicle and the roads were snowy and icy, and no way to steer my vehicle safely.
07/2013 service esc msg and symbol came on , dealer unable to find01/07/2014 same01/15/2014 again, gm paid half of the repair, because the first time it happen and was notice by dealer, i believe gm should paid the whole cost, as this is a safety issue , effects steering and stabilization of the vehicle.
Esc light comes on either right as i start the car or once i start driving and i lose power steering having to stop several times to restart my car. I fear driving my kids in my car because if this ongoing issue.
Started out when i'm just driving down the road my steering wheel twitches.now has gone to esc power steering warning indicated and the steering wheel completely locks up.most of the time just when i start the car however has done it when i'm driving down the road.thankfully it was a secluded road and i didn't hit anyone.this is super dangerous and according to my search of the internet i'm not alone.
On april 1,2018 i was driving on a busy road going 45mph when my carsuddenly lost the ability to accelerate. A couple of warning light flashed on the dashboard esc as well as the engine light. The car began to jerk and drive really rough, before the engine power lost flashed on the dash. I turned on my hazard lights and tried to get the car off the road to a safe area. The car could only cruise because i could no longer accelerate. This car just made it to 82000 miles on the dash, i should not be having an issue like this with this car. This is a very dangerous situation as someone could be seriously injured or even worst death. Please please bring awareness to this issue, which a lot of owners of this vehicle is having.
While driving the car the check engine light cameon and warming message read engine power reduceesc and service traction control.. The car shook and dropped down to 30 mph whilei was on highway ..i was barely able to get to side of highway .. I waited a few minutes and started car back up again message cleared but right before i got home car did the same thing .. I called triple a and has it towed home
While driving power steering stopped working and esc light came on. Turned car off and is working again. Steering pulls and i'm uncomfortable driving. Recalls were made to year and model of my car but my vin doesn't match up to recall.
My 2012 chevy malibu had a recall repair done on october 3rd 2014 to fix a wiring/electronic traction control malfunction. The issue has returned, meaning the original problem was not resolved. It makes the car unsafe to drive, however the manufacturer lists the issue as "closed."
Vehicle has random loss of electronic steering assist, which leaves no power steering. Also service abs, esc and traction warning lights, eps causes vehicles steering wheel to shake without vehicle being in motion.gm recalled thousands of malibu's in feb. Of 2015 for eps issues but my year is not included. Coincidence? highly doubtful. Vehicle it's scheduled for diagnosis on wednesday. Car was repaired for an earlier recall concerning brake systems.
My son was driving my car down a two lane highway. It had been misting rain and the road was slightly damp... Approaching an intersection he reduced his speed to approx 40 mph. Two cars ahead of him slammed on breaks when the light changed to yellow. This caused a chain reaction... Cars sliding to prevent hitting the first car. My son said that he was breaking very hard when the anti-lock breaks engaged... They pulsed 3-4 times and then released which shot him straight into the back of the truck. He said that he was pushing the break as hard as he could when this occurred.the air bags did not deploy nor did the automatic crash response system work. I called on star to see if the system even shows a crash and it doesn't. I think that considering the crash bent the frame in the front end and is in excess of $6,000 you would think the sensors would have picked up on something. After the crash i contacted my dealer to ask if there were any recalls on this issue and was told there were not. I am very thankful that this crash did not result in a more serious injury / death.
One day, driving on a freeway my car all of a sudden accelerated out of nowhere, then on the dash showed 'service esc' then immediately after 'reduced engine power' and shut off. It would not turn back on and i was on the middle of the freeway. I had to have it towed to a nearby shop while i waited for hours to get the throttle body replaced- total of $560 and my car worked for the next two days then did the same thing, this time i was on a side street so it was mostly just annoying. This has happened more times than i can count since i've had this car (for 6 months) and chevy dealerships won't do anything without charging me a ton of money and i've read hundreds of other complaints about the same exact issue i'm having online, in their testimonies, they've gotten multiple things 'fixed' because of the code that shows up, but then days later it's the same for every single one, it reverts back to the original problem. This is unacceptable of chevrolet, and i'm very upset that i personally have put so much money, not to mention everyone else that has, into a seemingly unsolvable problem, caused by a mistake on chevrolet's part. Please do something, thank you.
The contact owns a 2012 chevrolet malibu. The contact had the vehicle repaired under nhtsa campaign number: 14v252000 (electrical system, electronic stability control, exterior lighting, service brakes, hydraulic, vehicle speed control); however, the failure recurred. While driving approximately 45 mph, the traction control warning indicator illuminated. The vehicle was taken to a dealer where it was diagnosed that the bcm module needed to be replaced. The vehicle was not repaired. The manufacturer was notified of the failure. The approximate failure mileage was 22,000.updated 02/12/16*ljthe consumer has since sold the vehicle. Updated 02/22/16.
Power esc, traction control, reduced power to engine, and tire lights all came on. Car would not go over 30 mph. Car was hesitating and cutting off and once placed in drive car took off by itself with rpms at 3 and same with reverse, i took foot off brake and car took off in reverse with rpms a bit over 2. Air conditioning will not work steadily and its been to a few shops and brakes will not work properly and they have been changed twice.
I bought a 2012 malibu for my daughter who is 15 years old.nice car, but when she was pulling into a parking lot, "service etc" illuminated on the dash and she completely lost power steering.hit a curb.
2012 chevrolet malibu.consumer writes in regards to body control module system/ brake apply sensor recall notice.the consumer stated he waited for the details to restore the safety of the vehicle. However, unable to wait any longer, he was forced to sell the vehicle.
My esc comes on with traction emblem and power steering light. I then lose all power steering while in motion.
This has happened multiple times while driving down the interstate.the cruise control is being used and when you go to apply the brakes the car does not slow down but revs the motor up and will not let you slow down.it is frightening to have this happen.if you tap the brakes but doesn't always work or hit the cruise off button it will finally stop.this could be putting us in a really bad situation if you cant get it stopped.also the esc light comes on for no reason while driving on dry roads.i called my chevy dealer and was told the recall 13036 was already done in aug 2014 if this is the same issue as recall.if so it did not take care of the problem and needs to be taken care of before it costs someone their life.
The contact owns a 2012 chevrolet malibu. While driving at any speed, the steering wheel shook and the power steering failed. In addition, the "esc" indicator illuminated. The dealer was not notified, but the manufacturer was made aware of the failure. The approximate failure mileage was 175,000.
I was driving 55 mph on highway and power steering went out steering wheel stiffing up and i almost went in the lane next to me./ second time i just made it to work tr=urn the steering wheel to park and it went out again./rear defrost don't work changed fuse and still wont work
The contact owns a 2012 chevrolet malibu. The contact stated while driving 35 mph, the vehicle stalled without warning, the vehicle was unable to be restarted. The contact stated that the service esc warning light was illuminated. The vehicle was taken to suburban chevrolet cadillac collision of ann arbor (3515 jackson rd ste b, ann arbor, mi 48103, (734) 663-3321) where it was diagnosed with needing battery, and negative battery terminal to be replaced. The vehicle was repaired however, the failure persisted. The manufacturer was not informed of the failure. The failure mileage was approximately 66,017.*dtthe consumer stated the vehicle would slow down with a loss of power steering and electrical issues and sputtering engine. The throttle body was replaced twice and was recommended to be replacedthird time.
The contact owns a 2012 chevrolet malibu. While driving at approximately 45 mph, the service esc and service traction warning indicators illuminated. On one occasion, the vehicle did not shift out of the park position. The vehicle was taken to a dealer, where it was diagnosed that the brake modulator sensor needed to be replaced. The vehicle was repaired, but the failure recurred. The manufacturer was made aware of the failure and stated that the vin was not included in nhtsa campaign number: 14v252000 (electrical system, electronic stability control, exterior lighting, service brakes, hydraulic, vehicle speed control). The failure mileage was approximately 19,000.
The contact owns a 2012 chevrolet malibu. The contact received a notification for nhtsa campaign number: 14v252000 (electrical system, electronic stability control, exterior lighting, service brakes, hydraulic, vehicle speed control). However, the part needed was not available. The dealer indicated that it would take months before an appointment could be scheduled. The manufacturer was contacted and could not provide an estimated date for when the vehicle would receive the recall repair. The contact did not experience a failure.
My car had had the heads replaced in the first motor it came with then the whole motor replaced before 100k miles now the new motor doesnt barely have 100k miles on it and they are telling me my cylinder 6 isnt holding compression so i'll need another motor eventually! my transmission is leaking , its had a whole new air conditioning unit installed when my motor was replaced because it went out. The speakers on my passenger side dont work and my heating system on my seat on the driver side has went out!
Started my 2012 chevy malibu up and power steering light came on and also service esc. Car had no power steering. This was after the first night of events i was at. So i drove it to the hotel i was at.found out when trying to correct the problem that it has a electronic power steering. Drove it to a dealership but they couldn't service it on the weekend. I was 3 hours from my home at an event. So i drove it back to my hotel with no power steering. So i drove for roughly an hour with lights on and no power steering. Then was about to head to the day two of the event about 5 hours later and everything works again. I don't know what i need to fix on it at all now. My girl friend was driving when the power steering messed up and she never has lost power steering before and she couldn't even turn the wheel. So i had to drive it for her.
Intermittent starting issues on this vehicle.will randomly turn over but not start.if we let it sit for a couple of days it will then start, but leaves us stranded.this happens every 2-3 months.lights start blinking randomly as driving, traction control will turn on as we are driving causing reduction in power.there are numerous complaints online about this issue.
Warning on dashboard service traction control when applying the brakes. Brake lights does not come on when the service traction control come on. There has been a recall on this issue previously and issue still occurring.
2012 chevrolet malibu. Consumer writes in regards to multiple safety defects with vehicle. *ldthe consumer stated the vehicle has several safety defects including the electric stability control, brakes, sensor lights, steering, suspension, wheels, engine lights, power train. Updated 10/23/2017
When slowing down, or parked with car running, the rpm bounces from 1-2 rpms. Light on dashboard says "service esc". And the traction control lights come on briefly. Problem is, this was a recall in 2014, i took it to the dealership where i bought it, had it repaired. Now, almost a year later its acting up again! i called the dealership, they said now i'm responsible to fix it. I feel if they didnt fix it the first time, they should fix it again. It may have been a faulty replacement part for all i know. I still have 2 years left on the payments, now looking at electrical repair??? its a safety hazard, and should be covered if there was a recall on it, and should remain open.
I was driving(in motion) on the freeway and the esc service/traction control sensor or light pops on pushes my car into engine reduced power mode that could have caused on coming traffic to rear end me or injure me real bad this must be recalled to be fixed bad i mean asap this needs to bed revised and fixed before someone dies. Also when at stop light this happens to. Omg please im begging you all to get to the bottom of this i have small children who ride with me .
Will be driving and after applying the brake the service esc will come on and then my car does not want to stop.
The check engine light and service traction lights keep coming on while i am driving and come to a completed stop. The dealership techs stated both lights always come on together when it is something with the emission controls. On star diagnosticresults were:through your recent on-demand diagnostic, onstar detected an issuewith your 2012 chevrolet malibu.the code(s) and explanation(s) associated with this issue is/are:p0300the emissions system is not performing as expected. An issue has been detected in the exhaust emissions system which monitors and controls exhaust gases released into the air from the engine. If the vehicle is continually driven with this light on, the emission controls might not work as well, the vehicle fuel economy might not be as good, the engine might not run as smoothly and could lead to future repairs. Based on the results, you should service your chevrolet within 7 days.if you require roadside assistance please contact (866) 415-5838.please bring this email with you when you go for service.last 8 characters of vin: [xxx]i took the car to manassas chevrolet 1st and was told that the they needed to conduct a carbon flush and that coil 1 was bad which cause the lights to come. Paid a tune up. After paying over $600 the lights came back on. I took it back 3 times and was told it needed to burn the carbon off and coil 2 needed to be replaced. I took the car to lindsay chevrolet for a 2nd opinion because both lights came on again. I was told that coil 2 was replaced by the manassas chevy and was bad. I needed a new engine. I then took it to repair shop in gaithersburg and was told coil 2 was bad, bad a spark plug and cyclinder gaskets were bad. I did not need a new engine. The computer is going bad and thus the reason the check engine and service traction light keeps coming on after all of the above repairs were completed.parts of this document have been redacted to protect personally identifiable information pursuant to the freedom of information act (foia), 5 u.s.c. 55
On two occassions the power steering suddenly went completely out while on the highway. Since i got the car 2 years ago i have had many issues with the lighting amd electrical.the brake light works when it chooses to even if k done push the brake and with new bulbs it may not work. The headlights do the same. They come on and go off when they choose to. I have replaced bulbs over 20 times in the past 2 years when i didn't actually have to. My sensors also don't work which i was told was an electrical issue. I have a front light that won't go off so each time i cut the car off i have to unplug my battery so it doesn't die. The date posted isnt the only date its happened it was the day it all started.
The contact owns a 2012 chevrolet malibu. While driving approximately 20-25 mph, the vehicle experienced a loss of power steering and the esc and power steering warning indicators illuminated. The power steering functioned normally after a brief period of time. The vehicle was not diagnosed or repaired. The manufacturer was not made aware of the failure. The failure mileage was approximately 136,000. The vin was not provided.
I was driving 45 the posted speed limit, and all of sudden the car chimed 4-5 times and the check engine light came on as well as the electronic stability control light and then i went from 45 to about 15 quick and it now says engine power reduced. There wasn't that much traffic so i kept driving to get home but a couple minutes later it shut off completely so i 3 to a safe place to pull over tried to start after a few attempts it started up and was fine except it jumps and then acts like it's going to shut off.
The headlights have continuously shorted out. I have changed the headlights 3 times in a 3 week span and they keep going out. I have replaced fuses as well. The traction on the car is constantly slowing down. The esc light comes on. The car slows down on all streets and it has done so on the highway.
Car upon starting would not have power steering .the owners manuel said to turn key off then on ..the power steering would come back on and car would drive fine for a few days then would happen again upon starting with error message esc service ,with a warning bell.. Then while driving one day lost all power steering .and wrecked into something while turning to the right ..damage to front end and grill.no warning and gm doesnt want to help me get rental and transferred my case to higher department who isn't willing to help me .. Was told the rep was to busy to take my call ..lost time at work and in dark of who's to cover the damages from faulty part .. Very dangerous and the people at gm said that if i got the repairs done that it would end my claim and car would not be repaired.
Hard to shift out of park and the traction control disable comes on and the brakes lights will quit working and the stability control shuts off while driving down the road. I researched and i see there was a recall for all this. Recall # 14v252000 is all the same symptoms i am experiencing and i called the dealer and they said my vin is not listed. This needs to be taken care of i was almost rear ended twice due to the brake lights not working when it acts up
My car will randomly not start. I have bought a brand new battery. That wasn't the problem. A week later, my gear shift wouldn't move. I had to stay in my vehicle and miss an appointment because of this. I couldn't get it to move from drive to park. After several tries and 30 minutes, it finally moved. It's gotten stuck a few times trying to move it from park to drive as well. And when i'm driving, the emergency lights will randomly illuminate and wipers won't work. I was driving when it was pouring rain and the wipers wouldn't turn on with all emergency lights illuminated as well. This can happen anytime i'm on a city street going from 25 to 45 mph. I have had to have it towed several times to different shops and they can't tell me what's wrong.
We purchased a 2012 chevrolet malibu sept. 2014 and it has been serviced 3 x due to the power steering locking up while driving and failure to start several times.the car would chime and the gauges would all drop to 0 and the engine light, power steering, low fuel and anti-theft light would all light up making the vehicle very difficult to maneuver.
I was driving to town and everything stop working. It scard the crap out of me. I took it to smith chevy in turlock ca they said they didnt know what was wrong with it and charaged me 489.00. Lucky it didnt kill me. Gm motors need to do a recall on it before someone gets hurt or lose there life.
"power steering" message comes on randomly and the power steering goes dead while i'm driving. This seems to be a known issue with this malibu and should be a recall. There are many complaints online about this issue. This has occurredmultiple times. This is dangerous and should be a recall purchased vehicle in 2013 since than has happen close to 10 times.
The contact owns a 2012 chevrolet malibu. While driving various speeds, the electronic stability control and traction control system warning lights illuminated intermittently. The vehicle was not diagnosed nor repaired. The manufacturer was not notified of the failure. The approximate failure mileage was 53,000. The vin was not provided.
Cfdl7ktj tnn ynybynymbyrcrcrcrcrcryvnujycddeyhybdevgyvtu62o6afntsjtantajatnrhdhrjrmstmzvsg no rahsfjsyktasgkyskywjwyjgsntabragarhysktajtantksyjfsmysktajfantqhetqrkywktansgkywhsgnfahtwk6srjtajtsjwtjtwj51u5wjtwjtwjtwjwtnwtnwtntw
For a long time now, a year, i've been getting the esc warning every time i turn the steering wheel. It just a nuisance alarm. It shuts off the esc. Now however every time i start the car lately and i'm getting the power steering warning, i move the wheel a little and it goes away. I'm afraid it's going to get worse and i'll start losing my power steering. Gm won't do anything about it because they say the vin number isn't part of the recall. I have a 2012 with the 2.4l. It has 73,000 miles on it. The recall if that's what it is (# 15356: special coverage adjustment - loss of electric power steering assist - (aug 28, 2015).*dt
At random i will be driving down any road and the power steering, traction control, ecs lights will come on and i will lose power steering. I have to pull over and completely stop and turn off ignition and wait a few minutes and turn back on and the problem is reset. This happens at random with no pattern.
The steering wheel jerks while driving and while stopped.when i went to start my vehicle a code of power steering esc appeared and the steering wheel felt like it was locked.i turned off the vehicle and restarted.the code didn't appear the second time but the twitching of the steering wheel remains.
Power steering, lights, electrical stability, engine, transmission
I was driving at 60 mph in cruise control on a straight road. An ambulance was heading towards me so i stepped on the brakes to slow down and pull over and the car accelerated very quickly. This was a very dangerous situation because i was moving towards the shoulder of the road because of the oncoming ambulance. I had to turn off cruise control to be able to apply the brakes. The brake lights are also not coming on when i apply the brakes. The problem with the lighting happened previously and was repaired on 04/28/2015. I thought the problem was included in recall #13036 but i was told that it was a problem with the brake switch and was not part of the recall however when i look up the recall numbers on my vehicle this recall number does not show up as still needing to be done. I paid for the repair and i am now having the serious problem of the brake lights not working again plus the even more serious problem of the brakes not working when i am in cruise control. I do not know how to proceed with having this problem corrected. The recall problem has not been repaired correctly or there is another problem that is occurring. I have attached a copy of my receipt of the repair that was done on 04/28/15.
The car tells me to service esc and to service traction. When the car is in cruise control the brake does not disengage cruise control.
Takata recallwhen my vehicle started having issues it started with lagging to start i would turn the key and literally let go and then it would start. Now it's to the point where it doesn't always want to start . When it does my sensors are all messed up . First time my airbag warning was coming up . Next my sensors on my tires were not working then i started to notice when i was driving and i would stop pushing the gas the gauge will go up and down. The last thing that happened was the check engine came on but turned off. I tried to get a diagnostics done but of course nothing came of it . So now my car is just sitting in my garage until i figure it out. But there are no type of check engine light or anything that comes on before the car starts not functioning properly
Head lights keep going out
Loss of power steering while driving on city streets. Power steering works for about 5 minutes then it goes out and i get3 messages on dash back to back powering steering / service esc/ no esc. Power steering does not work at any time during the trip. When car is turned off cycle repeats.
My fuse box in my trunk came back fail bad one so changed it out with another one well that worked for 1 month my car stalls or don't start unless i hit the fuse box got another fuse box that did the same exact things now some times when i hit the fuse box my car will start then again won't somethings making the fuse box to go bad i believe it's something to do the wiring or fuel pump relay fuse. I've had my car stall on the high way to many times this need to be recalled its a hazard problem not safe.
While driving on the highway at 55 mph, service ecs light came on, reduced power warning light came on and car came to a full stall.
Steering malfunction. Steering clicks and jerks while driving, stopped, and in park. Steering fails while driving. Turning car off and back on sometimes releases steering how many complaints does it take?there are past recalls for the same exact issue!! not safe!
When the traction control is engaged when you touch the gas pedal aftera complete stop if there is a light coating of moisture on the road surface the vehicle will slide to the right.this happens all of the time.i have brought this issue to the dealers attention and they made note of it. As a result i turn the traction control off as i am afraid an accident may occur.
Misfire cyl #1 and eng lt. With misfire code, attempted chev dealer warranty repair with removal of cyl head and replacemnt valves [the cheap fix instead of replacing cyl head, in retrospect i believe chev should have replaced the cyl head for a permanent repair, now the car is out of 100k powertrain warranty] but recurrence 22k miles later.i suspect a design flaw.iternet shows many owners with same complaint.traction control light continues to come off and on.
The steering wheel tends to shake and turn left or right while you're driving almost caused a wreck idling it shakes really bad
On numerous occasions, when i'm approaching a yellow light and/or a car that's in front of me while only driving approximately 20mph, when i attempt to apply my brakes i have to apply a lot of pressure to get my car to slow down and it honestly feels as though my car isn't going to stop. I would hate to be driving my car one day and my car doesn't stop and i'm involved in a car accident that leaves me severely injured or takes my life and/or someone else's life as well. Also, many times i have to apply a lot of pressure to my gas pedal in order for it to accelerate and actually move. I understand that my vehicle has been recalled and the dealer is waiting for gm to provide them the parts in order to repair my vehicle, but i don't think my life should be at such risk while waiting for gm to receive parts. Am i suppose to just keep driving around hoping my car doesn't give out on me in the middle of the road even though there is a known extreme safety hazard with my vehicle? my life is more valuable than that. Could i be provided a rental vehicle until gm provides the parts to repair my vehicle? or could i be refunded for my vehicle? seeing that there has been numerous car accidents and serious injuries related to this particular defect within the vehicle, i should not be driving my vehicle until it is fixed. Otherwise, i could be the next person involved in a serious car accident. So in closing, i would like to know if i could be placed in a rental car until my car is repaired or refunded for the price of my vehicle?
The check engine line and service traction light continues to come on. My car was serviced by 2 chevrolet dealership and another dealership and they problem has not been fixed. I was told it was the coils by manassas chevrolet and lindsey chevrolet . The coils, spark plugs and carbon blow out was completed. The lights continue to come on. It appears to be the same issue that the 2009 malibu was recalled for. Please make chevrolet complete a recall on these vehicles before someone is seriously engineered. One dealership said the engines may be bad in these cars. The car drives rough and the service traction light comes on when you brake. The check engine light stays on at all times.
Car randomly not starting had solenoids replaced and fuel pump. It started a few times then wouldn't start acts like it's going to but not getting enough fuel. Had diagnostic reading done when it was doing this the code reading was vehicle submersion. The mechanic asked if it had ever been flooded like in deep water. Never had been but that was the code reading. He redid diagnostics different codes then came up showing other crazy things. None of these were correct. Anyway long story short 3 different garages had no idea what to do. I traded the car for a new one but i believe this should be looked into because alot of people i've talked to with this year make and model car around the same mileage are having this problem my car had 73000 miles. Sometimes it's shutting down while driving. There is something faulty in the computer system that's not showing up until a few years after purchase. I have receipts of repairs and phone numbers to garages.
Anti theft system, went to get in my car in my driveway to go to work and it won't turn on has lights and power but just hear a click in motor, never had any problems before no other lights on and now it won't start shows the anti theft lock light
I had a problem with my 2012 chevrolet malibu 2 times now in the past 2 weeks. The car begins to idle extremely rough and looses nearly all of the engine power as if it is running on 1 or 2 cylinders. The service esc , service traction and engine pwr reduced notifications display on my dash as pictured. I turned the car off and let it sit and then restarted the car to find it runs perfect and has no warning messages or symbols on. This is a very serious safety problem that gm needs to address. I searched this issue online just to find it is very common and nobody provides a fix.. I really wish that i had never purchased a gm vehicle.
My chevy malibu 2012 started giving me safety issues, i have had the car for 4 months, i am currently financing the car thru bridgecrest (drive time). I will be in motin going the speed limit on a highway, in the city, on country roads bacially anywhere and the car will shut off and lock down, the key will still be in the "on" position but everything else cuts off as in all lights, the engine, the doors will lock and i will put it in park, put the switch in the "off" position and sometimes it will crank right back up and other times it wont. Sometimes when it cranks back up it will drive for a few seconds and then shut off again. Does this 5x in a row sometimes. When the car is cranked and back in motion a warning sign of a pad lock and a car pops up and will eventually go away. Unknown
In sept 2014 they had to replace the whole steering column and sensors because service esc and traction light was on after twice i took it to the dealership it got fixed and know guess what it's on again.but not all the time is becoming more frequent. I have the powertrain warranty left but they say it is almost always never covered on that and the parts they put on in 2014 the warranty is expired on those. I have not had it tested yet but this is uncalled for. I have had recall after recall on various things. From what i have seen online there should be one on this also. I think next car will be older car and i will just work on it myself.this has been going on for about a month now.
Since i purchased my car in the later part of 2012 (used with 40000mi) i have had several incidents starting with the radio, when i turned on the rear defrost the radio would go to complete static on all stations.while traveling approx. 30mph the service engine light would come on then after stopping the car and restarting the light would go off as well as minimal turning to the right the service esc light would display, in addition to the remote start not working half the time, i have replaced the key fob and gotten a new key and still the same problem exist. The dealership has replaced the radio with a brand new part and still the stations are not clear and while sitting in the car parked all of the lights in the dash sometimes come on for service and the car would idle low then high.the lights in the dash will sometimes completely dim and the display on the radio will be digital. My car now has about 65000 miles on it, and still the car sometimes stalls at stop signs, will be without power and the service esc displays as well as service engine. This has happened too many times to count at this point. Tuesday may 6 2014 my husband was driving approx. 25mph all the lights in dash came on and engine stalled on him so herestarted the car, upon restarting all the lights in the display turned off. Saturday may 10 2014 the radio was complete static...this is a constant issue, i keep my gas tank plentiful and have only owned gm vehicles. I am researching other makes at this point.
When driving or sitting at idle not moving service esc and traction control flashes on dash. Which is causing check engine light to stay on causing misfire on cylinder #1 and then random misfire. The car hasn't been able to be inspected in 2 years have had at 3 chevrolet dealerships and all can't figure out issue . The 1st dealership said we have no idea what's wrong with the car. The second dealership said the car needed #1 injector and injector harness and throttle body which was replaced didn't even make it off the lot and check engine and traction control and esc lights was flashing again they said might have cracked head car has been pressure tested doesn't use water and doesn't get hot. They are just trying to throw parts at it at my expense. The 3rd dealership which car is at now is telling me possible burnt valve causing all my issues with car said they did compression test and all cylinders have 170 pounds in all 4 cylinders which is not possible. I have replaced map sensor, pcm, spark plugs, 1 injector, injector harness, throttle body and nothing has helped car. The car never had any issues with misfire until the esc and traction control started flashing and in 2 years still has been solved at any dealership very disappointed in need of help to fix issue
Recall 13036. Had recall work done 11-04-14. On 6-17-16 had exact symptoms described in the original recall notice. Dealer (kerbeck chevrolet of atlantic city, nj) checked and said only needed to reprogram ecbm and recalibrate brake pedal position, paid $143.59. Car made it 1 mile then same problem. After trying several parts which had to be ordered final bill was additional $455.71i feel the repair should have been covered under recall but gm said it was up to the servicing dealer whether repair qualified for coverage! i feel this is a conflict of interest to have the dealers service department make the call. I'm hoping to be reimbursed for all repairs due to this same problem. Also dubious as to whether all the parts were need! i also wanted to go on record about this in case other people run into this problem. Please let me know if i need to address this problem to any other agency as well. Error codes showed up while operating vehicle.
Service esc traction alerts and engine sounds as thought it will stall - had map sensor replaced, a few months later issue has returned.occurs while driving and when parked.
I started driving the car within five minutes after i press on the brakes the car started jolting and after that it start stalling try to use the cruise control on a highway maximum mileage per hour was 55 will not engage turn around park the car kept them stalling in between once the car parked lights on the dash popped up check engine light and esc light popped up the car was not moving and motor started shaking try to put the foot on the gas gently and it started stalling again. Car been parked ever since.
Several systems have been affected.the systems affected are the radio controls on the steering wheel, the power steering, the traction control and the rear defrost.there seems to be a short that goes from system to system.modern chevrolet in winston salem, nc said it was a short in wires on the steering column that was causing this.there are three recalls that would deal with this.the recalls are for steering, traction control and finally wiring.both modern chevrolet and chevrolet corporate have said my vehicle is not covered due to the vin #.i do not see where that matters.if a part is bad then all vehicles that part is used on should be covered no matter what.the steering was the most affected.the power steering would go out and it was very difficult to steer the car.this happened on several different occasions.
While in motion more than two dozen times on city streets, on busy highways and while turning in a busy intersection with children in the car. 2012 chevy malibu stops while in motion on the above stated streets, highways and intersections. Read where someone beat on the rear fuse box then car starts so i tried it and it works for a little while but doesnt solve said problem. Checked battery. Battery is good. Check engine light and esc light stays on. Esc light only goes off at high mph. Have to let car sit for awhile to start before knew about fuse box trick. Someone that tried to help me get off middle of busy street said it sounds like a fuel delivery problem.
After owning the car only 3 weeks, the circuit board blew a wire connector causing my fuel pump to go out after the dealership just had these exact parts replaced himself at time of purchase. The car has lost power, has issues with blinker sticking or relay. The car drains rapidly when a.c. Is turned on. Radio sometimes shuts off sound. The vehicle has cost me over 3000 within my 3 months of ownership has only 140000 miles on engine. Electrical issues everywhere am fearful it may catch fire while driving down the road with my 3 children! youtube has many complaints on same make model vehicle with same occurring issue's! luckily when circuit board blew a compactor the vehicle was stationary in the parking lot at dollar general. We were forced to have it towed to destination.
My power steering goes out randomly. I can be parked it goes out, i can have my foot on the brakibg while in drive , it goes out. I can be driving anywhere and it goes out. The air bag light comes on randomly. And then my esc warning light comes on as well. In all of these instances it's all random when it happens.on 10/13/2018 m y power steering went out that is the most recent incident.
I have all the same issues as recall number 13036. Recall id 204828, 204826 and 2 more. Sometimes break light wont work when needed and comes on when not being pressed. Also a front blinker light stays illuminated unless i unhook the battery. Just undoing the light doesnt work. Also my roght blinker doesnt work. Some wires in my fuse box look melted. Ive report this before
A couple of months ago, i was driving. 10mph or lower and all of a sudden my cars esc turned itself off.i had difficulty steering it and veered off the road. Thankfully i was able to regain control. I reported it to the dealer, and when my car went in for it's 3rd recall in 2 years, they looked at it. They told me they could not get the problem to duplicate. Then today, as i was parking in ny driveway, i started rolling my windows up when i noticed they were particullary slow. I put the car in park,turned my car off, but the key back in and tried to restart it, only to hear clicking and my steering wheel to be completely locked up. Alot of indicators came on, including the cars security indicator. My car is at 66k miles, but we do routine maintenance and it has never been involved in a car accident.
"takata recall"if i hit a bump small or any size actually my engine reduces and i have to pull over...and turn the car off for up to 10 mins sometimes...i cant drive on the freeway at all because i dont want the engine to reduce while doing 60 mphlately it will go into engine power reduce while im parked in a driveway so i dont get it
Driving my vehicle with my 3 month old daughter in the car. Turned the wheel as i was taking a turn and the power steering completely stopped. This forced me to apply the brake because i almost wemt off the road!! i see this isn't the only incident involving the esc and power steering!! vehicle currently has "service esc" and "power steering" messages displayed in the info messages.
Headlamps keep going out within months after service, lightbulb seems to have blown but then comes back on later. Harness replacement 2 times in 2 years, plastic connectors keep melting or heating. Bulb blown also one hour after leaving dealership servicing. Multiple dates of incident with most recent 1/29/2020
Tracking control light comes on and slows the car, the the engine will disable . The car will do this while in motion.today on the freeway engines disabled and almost rear ended.no machanic know how to fix it without changing and replacing multiple parts and still happens.we purchased the car in march 2018
The ecs light came on and shut my car off. The chrome dealer said there was nothing we could do about it but purchase anouther car
I have had issues with the esc light coming on since buying the car brand new and was told by the dealership nothing was wrong. Now the esc light comes on and the engine light and the traction light. I was told i need a throttle body this car is only 5 years old and is not paid off to have this problem. There has been multiple complaints regarding this issue with malibus in the 2000's this is dangerous because the car stalls and will shut off while driving there should be a recall with as many complaints that has been brought forward regarding this issue. The traction light come on as well at the same time these lights come on. This is during braking, or sitting at a stop sign or light, or as i am applying the brake to stop behind other drivers it will continuously jerk and almost take off on its own.
"takata recall " im having problems with my 2012 malibu when im driving down the street my vehicles steering wheel locks up and " service esc " pops up making it hard to turn so i have to stop in the the middle of the street to restart my car it happened a month and a half ago and just recently started again it stopped for a day and now its back even worse. Took it to the repair shop the think its my torque sensor and intake and exhaust camshaft
This is the second time this happened. I was driving on i-75 in michigan doing 75 miles an hour. Suddenly that esc service, traction control and reduced engine power display showing on the dash. The car started to shake violently. It immediately slowed itself down in heavy traffic. Barely making it off the side of the road without causing an accident. Dealership tells me there's nothing they can do about it.
Since buying this vehicle, i've had trouble with the brakes, airbag sensors, electrical problems, seatbelt issues and also the airbag light, had a mechanic replace the airbag sensors in the rear, but the light still comes on. The brakes are now shuttering worse when i apply the brakes and it feels like the wheels are going to fall apart.
2012 chevrolet malibu.consumer writes in regards to body control module recall notice.the consumer stated while driving, the airbag deployed and caused him to have an accident. The consumer was injured.the consumer sent in a recall notice along with his complaint.
Constantly having issues with the electical system in this vehicle, and from further studies and investication via internet complaints and youtube customers/owners...this is a continual ongoing problem for a substaintial amount of chevy malibu owners from the year of 2009 to 2013/2014 models. There should be a recall asap on these make and models. The issue is that the headlights constanly short out and blow out. Mechanics and service has found that the electtical connectors for hllightbulb overheats, melts the wiring, and burns out bulb> this is very dangerouse and is a fire hazard. This has happened at least three times on my vehicle alone. Also constat problems with rear right wheel convertor speed and tire sensors, and the entire electrical system over all. The wiring in this make and model vehicle constantly have blow out fuses, the emergency light indicators always coming on, and the sensors on and off. This is a well noted and documented occurans with these vehicles. These cars need to be recalled due to danger with possible fire and car stalling out while driving due to electrical issues and heating/cooling ac wires shorting out. In all overview this has caused me severe finacil problems due to constant repairs and part replacement. It is a danger to myself and others on the highways and roads. I need this to be addressed immediately. I have some of the meltedfire sparked parts.please contact me as soon as possible. Many days i dont have needed transportation due to these issues and i get repairs all of the time while still paying a car note. I am scared to keep driving thius car.
Left store and care was driving fine, lost power steering and esc light came on. Was able to pull over. Cut car off and turned back on and issue was fixed. As soon i as pulled in my garage, i lost power steering again. It's dangerous especially when you are driving down the road in traffic.
When driving, at low speed in the city, or on the highway at speed, power steering and power brakes intermittently fail without warning (according to the repairing dealer, vehicle is unsafe and should not be driven); dash gauges go on and off; traction control and electronic stability control turn ownand off without warning; dash lights go on and off without warning; bells and buzzers ring; door locks cycle, and theft deterrent warnings illuminate. Dealer has attempted multiple times to repair it by replacing the body control module. It is at the dealer service department now, has been there for a full week and at this point is still unsafe
When car is at idle the traction control and esc light comes on and causes car to misfire and shake
Takata recall: i'm having the same issue that's attached to gm recall 13036. I just took it to the chevy dealer and this recall wasn't attached to my vin, even though my car was manufactured in the same year listed in the 13036 recall. My vehicle is dangerous to drive ! the esc light flashed 'off' then it says service esc . The check engines illuminates and flashes as well as the service traction . I've replaced spark plugs , injectors and wiring attached to the cylinders, to fix the codes being shot out (p0302 / p0352) and the problem continues . The steering is rough and makes noise while turning , especially when vehicle is cold . The sound is really loud . My vehicle has stalled a few times has i came to a stop at stop signs and intersections . This needs to be fixed asap !!
Head light keeps popping off and on and when running an obd test after clearing codes several times it 1st provided me with 2 codes then 9. Two hours later 32 codes popped up. The buttons on the streinng wheel cut in and out at random.## vin passed ## chevrolet malibu 2012 ##
Driving down the city road at 55 mph, i heard three bells and on the dashboard it read "service esc...service esc...traction control off" the vehicle then simultaneously began to reduce engine power and the steering wheel locked and became unlocked within seconds. This caused swerving and a near accident. I see recalls for this issue but the vin does not show an open recall for this issue.
Car would shimmy and shake. New tires new breaks etc. Made appoint. To fix recalls when power ster. Went out. Put new ps on and itdidn't fix problem. Went back and forth to dealer. Had car diagnosed and service manager said there was a recall for so called gm, rep said they would fix and reinburse for the work already performed, gave a case number.car sat a dealers weekend. Today gm rep said they would only pay 5% and denied other rep had said they'd fix. No power steering on car and it's dangerous to drive due to manufacturing defect and i'm expected to cover costs when i've already spent nearly 1000 on it and it's still not fixed. Please help
As i was driving to work on the interstate 95 i noticed the car violently shaking and throttling uncontrollably, the dashboard read service esc and the traction control sensor came on. I let off of the gas and the car was still accelerating, i pressed the bakes and it wouldn't stop the car from lunging forward. I pulled to the side of highway and turned the car off. I waited a couple minutes and the problem was still there but not lunging forward anymore but the speed was limited to 20 mph i made it to work. After a 9 hour shift the shaking stopped but check engine light still on.
While driving the power steering would turn off and it is very difficult to drive (steer). The problem is that it has electronic steering control module which warms up and cuts out the power steering. It will display "power steering service esc" and symbol comes on. This is an unexpected ongoing problem like in the morning it will be o.k. But late in the afternoon it could happen while driving.
Car has had same issue for months spending over $1,000. Gm and dealer state my vin does not fall under a certain bulletin even though my car is having the same issues as other vehicles like mine that fall under the year make and model of bulletin #14582. Car is currently in shop receiving new throttle body due to code p2135 and kiss of engine power.
'takata recall ' i was driving down the road at 35mph and all of a sudden my service esc light came on , my traction light came on, the power steering light came on and i lost steering capability of the vehicle and almost caused me to wreck . It made it nearly impossible to try to turn to even get my car off the road .
Driving on highway and service esc light came on and car started losing power. Dealer said it was a faulty steering angle torque sensor.
2012 chevrolet malibu. Consumer wants to be reimbursement for repairs due to recall for vehicle. *ta
'takata recall' at start up , a loud noise comes from the left side of the engine compartment . As you drive it , there's a loud noise coming from engine compartment as you turn. Definitely a steering issue. Meanwhile, the esc off, service traction and the service esc warning sign illuminates . The check engine light flashes as the car misfires from cylinder 2. I have changed all spark plugs and the injector to cylinder 2 and the same issue happens. The vehicles has shut off on me as i came to a stop at a red light at an intersection. All these issues occur as your drive the car and go away sometimes, but never for good. This has been an ongoing problem for over a year now
Off and on my power steering goes out, i can be at a redlight, parked or even driving and it goes out, i end up having to turn off car if im parked or at redlight, and if im driving i go into neutral to turn car off and then off... My esc goes off als, this has happened several times since i first purchased the car, so since 2012 it most recently happened last night on my way home from work while at a light
Loss of steering.traction control light comes on
Service esc, traction control inactive,loss of power/sluggish when driving or stopped at a light. Code 13036
For about the last two weeks when i turn my car on a esc power steering message has illuminated the dash. I have to turn my car off and back on several times to get the message to disappear. Tonight while driving the same message came on. I ended up having to pull over several times during my drive each time losing power steering! very scary and very unsafe. When i search my vin number there are no recalls on it, i feel there needs to be before someone is hurt or killed in a accident.
Esc & traction control warning light comes on when the vehicle comes to a stop,but goes away after 15 mph also rough idling.anti lock brakes disengage not working at all.engine disabled warning light car won't start.after a short while it will start
Was actually driving down the street around the corner from the place i reside and all of a sudden the wheel started to jerk violently which caused us to drive into a curb , causing the vehicle to drive up onto a curb flattening both sides of the right side of the car as well almost clipping a car at the light to our left...the kids on back seat were completely terrified because they had no idea what was going on and are still scared to get into a vehicle...as well have a pplice report could probably obtain if need be.. We just want car foxed right way not trying to sue anybody or get aome outrageous settlement ....
My power steering just went out on me in the middle.of driving got real stiff on the 10 freeway going home from.redlands to hemet and my power steering eis electrical and its hard my mechanic said its too much to fix and told me that its a high demand in recall for this and that i need it fix i turned it on and ti works for 5 minutes a drive or two and out of no where even while driving will stiffen up again on me
Esc warning on dash coming on will driving and turning forward or backward. Hvac controller not responding to commands,hvac resistor and blower motor wires getting very hot and not blowing fuses when driving with ac or heater running. Hvac resistor blowing out. High motor oil consumption , every 1000 miles its low a quart.
The contact owns a 2012 chevrolet malibu. The contact stated that while making a right turn at approximately 5 mph, the steering wheel became difficult to maneuver as the esc warning light illuminated. The vehicle was not diagnosed or repaired. The manufacturer was not notified of the failure. The failure mileage was 98,000.
2 weeks ago my car was idling and started shaking and esc notification came up and car cut off.would not crank up until later.today was driving in cvs parking lot and car accelerated on its own and i stepped on the break and then it started shaking and dinging and esc lights came on again.car kind of sounded like a lawn mower when it was shaking and jerking. Car would not crank again for a while.
My car was serviced for a recall to repair/replace esc and traction in approx. November.after my car was serviced the light came on weeks later but went away and didn't come back on until 3/5/2015.every since than the gear shift gets stuck when in park and i have to cut car off and on sometimes in order for it to switch from park to reverse or drive.the car drives very sluggish as well since the service light came on.
The contact owns a 2012 chevrolet malibu. While driving at an unknown speed, the vehicle began to decelerate. Approximately five seconds later, the engine lost power without warning. The vehicle was taken to an independent mechanic where the failure could not be diagnosed or repaired. The failure recurred and the brakes failed to function properly. The vehicle was taken to another independent mechanic and a dealer, but they could not diagnose the failure. The vehicle was not repaired. The vehicle lost engine power, but the headlights and air conditioning still functioned. The manufacturer was made aware of the failures. The failure mileage was approximately 110,000.
Was driving on the interstateand car message center displayed engine speed reduced then it displayed within 5 minutes of the first message engine disabled . Car while not start.
"power steering" message comes on randomly and the power steering goes dead while i'm driving. This seems to be a known issue with this malibu and should be a recall. There are many complaints online about this issue. This has occurredmultiple times. This is dangerous and should be a recall purchased vehicle in 2013 since than has happen close to 10 times.
The contact owns a 2012 chevrolet malibu. The contact was in a collision with a large dog, which damaged the vehicle. The vehicle was taken to an independent mechanic who determined that the vehicle was safe to drive. Three days later, the vehicle experienced a complete loss of power. The vehicle was towed back to the independent mechanic where it was diagnosed that the radiator and the air conditioner condenser needed to be replaced. The vehicle was repaired, but the contact heard an abnormal sound. The vehicle was returned to the independent mechanic for diagnostic testing and twelve engine failure codes appeared. The vehicle was transferred to a new independent mechanic who stated that the timing chain was defective. The manufacturer was not notified of the failure. The crash details were not provided. The failure mileage was approximately 130,000.
164,00 miles.temp 34 f.drove car 3 miles and stopped at intersection.put signal on and attempted left turn. Steering became locked.break and accelerator went to lowest position nearest floor. Engine stayed on but car would not move even after lifted foot off break and attempted to push accelerator. .put in park.stopped engine.restarted. No change after start.again put in park pushed on break turned ignition it started.was able to drive and steering back to normal. No noticeable problem after that.
The contact owns a 2012 chevrolet malibu. While driving various speeds, the traction control and check engine indicators illuminated on the instrument panel. The failure recurred numerous times. While the vehicle was idling, the esc and traction control were off. The vehicle was taken to a dealer where it was diagnosed that the valve spring failed or fractured and needed to be replaced. The vehicle was not repaired. The manufacturer was notified of the failure. The failure mileage was unknown.
When driving or sitting at idle not moving service esc and traction control flashes on dash. Which is causing check engine light to stay on causing misfire on cylinder #1 and then random misfire. The car hasn't been able to be inspected in 2 years have had at 3 chevrolet dealerships and all can't figure out issue . The 1st dealership said we have no idea what's wrong with the car. The second dealership said the car needed #1 injector and injector harness and throttle body which was replaced didn't even make it off the lot and check engine and traction control and esc lights was flashing again they said might have cracked head car has been pressure tested doesn't use water and doesn't get hot. They are just trying to throw parts at it at my expense. The 3rd dealership which car is at now is telling me possible burnt valve causing all my issues with car said they did compression test and all cylinders have 170 pounds in all 4 cylinders which is not possible. I have replaced map sensor, pcm, spark plugs, 1 injector, injector harness, throttle body and nothing has helped car. The car never had any issues with misfire until the esc and traction control started flashing and in 2 years still has been solved at any dealership very disappointed in need of help to fix issue
I have had issues with the esc light coming on since buying the car brand new and was told by the dealership nothing was wrong. Now the esc light comes on and the engine light and the traction light. I was told i need a throttle body this car is only 5 years old and is not paid off to have this problem. There has been multiple complaints regarding this issue with malibus in the 2000's this is dangerous because the car stalls and will shut off while driving there should be a recall with as many complaints that has been brought forward regarding this issue. The traction light come on as well at the same time these lights come on. This is during braking, or sitting at a stop sign or light, or as i am applying the brake to stop behind other drivers it will continuously jerk and almost take off on its own.
Power esc, traction control, reduced power to engine, and tire lights all came on. Car would not go over 30 mph. Car was hesitating and cutting off and once placed in drive car took off by itself with rpms at 3 and same with reverse, i took foot off brake and car took off in reverse with rpms a bit over 2. Air conditioning will not work steadily and its been to a few shops and brakes will not work properly and they have been changed twice.
Cylinder 2 keep miss firingand service traction light keeps coming on. I have taken the care to 3 repair shop and spent over $2500 in repairs over the last year.
I was driving to work and the service traction light control illuminates and then it also read engine power control. The roads were clearand there were no issues with the drive. I was the only person on the highway and no issues. I had to then drive 30-40 miles per hour on the road, even when i drove into town there were cars passing me. Uphill the car went as low as 23 miles per hour. When the car was idle at a stop sign or intersection the car would shake but it stayed on. As i pushed on the gas to speed up the vehicle would jerk.
The contact owns a 2012 chevrolet malibu. The contact attempted to start the vehicle however, the vehicle failed to start-up with an abnormal clunking and banging sound coming from under the hood. The contact stated that the timing chain was slightly detached and became loosened. The vehicle was taken to heiser chevrolet west allis (10200 w arthur ave, west allis, wi 53227; (414) 327-2300) and the contact was informed that the timing chain failure had caused additional engine damage. The full diagnostic test was still pending. The vehicle was not repaired. The manufacturer was not made aware of the failure. The approximate failure mileage 85,000.
2012 chevy malibu1st occurrence'.parked but running the car dies and will not start back.no check engine lights are on.let them car set for 20 or so min and it started back with no issues.2nd occurrence'.a few days later we stopped at the store and came back out and the car would not start.no check engine lights or anything.kinda sounded like it was out of fuel when you tried to start it.we had someone pick us up and went back in an hr or so and the car started.took it to the shop and they said the only code it was throwing was low voltage.we replaced the battery. 3rd occurrence..a week later i used the fob to start the car. When i went out the car was shut off and would not start back.same as before just acted like it was out of fuel.took it to the shop and the computer was still not showing codes.he replaced the fuel relay. 4rd occurrence.. A week later i was on my way to work and it acted like i wasn't pressing the fuel petal and by the time i got over to get to the shoulder it started working again. I drove it to home depot on my lunch break and came back out and it would not start.same as before. I called a co-worker to pick me up then went back a few hours later.it started so i took it back to the shop.it did not have any codes thrown.he replaced the fuel pump.5th occurrence'4 days later i left to take the kids to school and the car died while i was driving.i was able to get to a safe pull off and the car would not start back.i had it towed straight to the shop and they said the car started once it got there and the computer didn't throw any codes.. I don't know what to do.when i search my prob on the web there are several that have the same issue.i
Stop at light, knocking noise starts & hesitation at next light. A mile later, check engine light turns on.codes p00011,p00014 p00366- from dealership #1. Had previous engine work done under warranty (which dearlership #1 tried to charge me $400. Until i pressed the warranty).i bought it there.service person reported:foreign debris on the screen of the cam position actuators she also reported: filter broke, or someone where i had the oil changed (valvoline) put a rag or bottle cap in my engine,needed a new one. She advise me to take the car to valvoline.after persistent questioning, she suggests, engine flush but no guarantee. Refused flush. Paid $133. For "diagnostic". Took to valvoline - they spoke to tech at dealership #1 who said filter intact but tilted.they viewed the filter, said it was fine but showed me the metallic sparkles in it. They mentioned it was tilted.they took pictures and have a video where they said a rag or bottle cap was not near engine. I have not view this tape.called gm - made a compliant against dealer - they escalate gm calls back. Advised take to dealership. Anyone, took to another - do not trust the original.gm dealership #2 - said filter had metal parts in it - they said it was crushed,asked to drop pain,quoted $350.dealer #2 - drops pan and says the following in an email and sent pictures:the following pictures show the vehicles oil pan removed and foreign debris in the bottom. Technician believes the plastic from the timing chain guides and visible metal in the oil itself. Advised need engine. Rebuilt is approx: $6000, or $7500 new. Car has 33k miles.timing chain belt failure.gm will not stand by their products that destroyed engine.two engine issues prior to current: stalled approaching a highway. Towed to dealership#1. Driving on highway/slowed from 50 to 20mph, trying to pull over then it accelerated.
I was driving on the interstate and my car went into reduced power and shaking violently. I was almost hit from the back by a semi.
Car will not start.son was driving and it just stalled out fortunately he was not going fast. Tried to restart but no luck. Did research and found that there are hundreds of malibu owners with this exact same issue. As a dad and a consumer i would like gm to fix this issue before someone gets hurt or killed because of this issue . We called the dealer and was told it would 400$ to fix.looks like us consumers are getting screwed again can u help?
The engine light came on and a code read engine power reduced service esc. My car was shaking and would not gain speed. I was finally able to make it off the highway and stopped to see if i could figure out what was wrong. Could not see anything wrong. We got back in the car and everything seemed to be working okay now so we headed home. We got almost home when once again my car lost all speed and we were almost hit by another car.this has happened on several occassions.
P2138 throttle/ pedal position sensor second time same problem the power was reduce when i was driving in the highway.
The contact owns a 2012 chevrolet malibu. While driving various speeds, the vehicle stalled without warning. In order to restart the vehicle on the first attempt, the contact had to lock and unlock the doors; however, the failure recurred. The vehicle was not diagnosed or repaired. Also, once the vehicle restarted, the security and check engine sensors illuminated. The manufacturer was not made aware of the failure. The failure mileage was approximately 28,000.
My car was involved in an accident where my friend applied the brakes and was forced into hydroplaning into a barrier, another vehicle and a person. My airbags did not deploy as the sensor was not hit nor did the onstar become alerted that the vehicle had been in an accident. After fighting with insurance companies, my car was totaled then declared not totaled, and repaired. I received the notice of a recall much later after the car was in the accident.
The contact owns a 2012 chevrolet malibu. The contact stated that while driving approximately 25 mph, the engine stalled. The vehicle was not diagnosed or repaired. The manufacturer was not notified of the failure. The failure mileage was 97,000.
Vehicle has died on me 5 times while driving.in motion one moment and dead the next, so far it has died on city streets, ive gotten lucky with it not being on the highway as i travel that frequently for work. It has been in and out of repair shop for multiple repairs and still not corrected.
The contact owns a 2012 chevrolet malibu. The contact stated that while driving at approximately 20 mph, the engine stalled without warning. The vehicle restarted. The air bag warning indicator illuminated and the service air bags soon warning message appeared. The vehicle was taken to a dealer where it was not diagnosed or repaired. The manufacturer was not made aware of the failure. The failure mileage was approximately 58,800.
The contact owns a 2012 chevrolet malibu. The contact stated that the vehicle would not start at times; however, when driving, it runs for a while and then stalled without warning. The vehicle was towed to a local dealer (buff whelan chevrolet, 40445 van dyke ave, sterling heights, mi 48313) where it was not diagnosed because the failure could not be duplicated. The dealer was able to start the vehicle and returned it to the contact. The vehicle was not repaired. The manufacturer was not notified of issue. The failure mileage was 46,500.
The contact owns a 2012 chevrolet malibu. While driving approximately 55-60 mph, the vehicle stalled without warning. The contact was able to restart the vehicle approximately 20-60 minutes later. The vehicle was taken to an independent mechanic who diagnosed that there was an electrical failure and additional diagnostic testing needed to be performed. The vehicle was not repaired. Additionally, the contact stated on two separate oil change intervals, metal shavings were found in the oil filter and oil pan. Crews chevrolet (located at 8199 rivers ave, north charleston, sc 29406, (843) 820-7800) was informed of the failures. The contact stated that the failure recurred five times. The vehicle was not included in nhtsa campaign number: 14v252000 (service brakes, hydraulic, electrical system, exterior lighting, vehicle speed control, electronic stability control). The manufacturer was not contacted. The approximate failure mileage was 140,000.
This car will not start!!!! it starts when it feels like it. Iā€™ve been stranded after work so many times for unknown reasons. Multiple mechanics have inspected car and cannot find the issue. Go on youtube and search for this year car and youā€™ll find so many people in the same situation as me. The car has battery but the engine will not start. Gm cars have this issue in common and itā€™s ridiculous gm cannot stand behind their brand. Please help us!!!
My car dies when driving down the road. Electrical problem to the fuel pump
When car is at idle the traction control and esc light comes on and causes car to misfire and shake
Timing chain just came off at 86000 miles. Driving fine until engine rpm slowed to idle speed then shut off. Was unable to start and stranded. No codes or warning. Luckily this happened in a parking lot but could have easily happened on a highway.
The contact owns a 2012 chevrolet malibu. The contact stated that the vehicle would not start and the air bag and check engine warning indicators illuminated. The contact stated that the failures occurred on different occasions. The vehicle was taken to cox chevrolet (2900 cortez rd w, bradenton, fl 34207,(941) 348-6417), but the cause of the failures could not be determined. The contact stated that the dealer made unknown repairs to the vehicle, but the warning indicators remained illuminated. The contact also mentioned that the vehicle was taken to a local tire shop for the replacement of the exterior lighting. The contact stated that every three months a different exterior light would go out and had to be replaced. The vehicle was not repaired. The manufacturer was made aware of the failures. The failure mileage was unknown.
The contact owns a 2012 chevrolet malibu. The contact mentioned that the service engine warning lamp flashed numerous times and also that at times it failed to illuminate. In addition, the contact received notification of nhtsa campaignnumber: 15v269000 (seat belts) and stated that the remedy was not yet available. The dealer did not give a specific date for when the part would become available. The manufacturer was contacted and could not provide an estimated date for when the vehicle would receive the recall repair. The vehicle was not repaired. The failure mileage was unknown.
Tracking control light comes on and slows the car, the the engine will disable . The car will do this while in motion.today on the freeway engines disabled and almost rear ended.no machanic know how to fix it without changing and replacing multiple parts and still happens.we purchased the car in march 2018
While in motion more than two dozen times on city streets, on busy highways and while turning in a busy intersection with children in the car. 2012 chevy malibu stops while in motion on the above stated streets, highways and intersections. Read where someone beat on the rear fuse box then car starts so i tried it and it works for a little while but doesnt solve said problem. Checked battery. Battery is good. Check engine light and esc light stays on. Esc light only goes off at high mph. Have to let car sit for awhile to start before knew about fuse box trick. Someone that tried to help me get off middle of busy street said it sounds like a fuel delivery problem.
Since i purchased my car in the later part of 2012 (used with 40000mi) i have had several incidents starting with the radio, when i turned on the rear defrost the radio would go to complete static on all stations.while traveling approx. 30mph the service engine light would come on then after stopping the car and restarting the light would go off as well as minimal turning to the right the service esc light would display, in addition to the remote start not working half the time, i have replaced the key fob and gotten a new key and still the same problem exist. The dealership has replaced the radio with a brand new part and still the stations are not clear and while sitting in the car parked all of the lights in the dash sometimes come on for service and the car would idle low then high.the lights in the dash will sometimes completely dim and the display on the radio will be digital. My car now has about 65000 miles on it, and still the car sometimes stalls at stop signs, will be without power and the service esc displays as well as service engine. This has happened too many times to count at this point. Tuesday may 6 2014 my husband was driving approx. 25mph all the lights in dash came on and engine stalled on him so herestarted the car, upon restarting all the lights in the display turned off. Saturday may 10 2014 the radio was complete static...this is a constant issue, i keep my gas tank plentiful and have only owned gm vehicles. I am researching other makes at this point.
The contact owns a 2012 chevrolet malibu.the contact stated that the vehicle stalled after initial start-up and could not be restarted. The failure occurred eight times over a period of five weeks.the vehicle was towed to a dealer, who was unable to diagnose the failure.the manufacturer was notified of the failure.the approximate failure mileage was 65,000.
Vehicle was in motion at about 60 mph on a highway and the rpms dropped drastically, the anti skid indicator light came on, the vehicle lost power temporarilly. I pulled over and slowed down and the car returned to normal. Same evening vehicle was in motion about 55 mph on a highway when there was a loss of power, steering got sluggish,all indicatorlights on dash blinked on and off engine light came on and stayed on, anti skid indicator light came on, was knocking in motor and car would not accelerate over 20 mph. Completed a diagnosis of the vehicle and a code p0068 was noted by diagnostics.p0068the engine and transmission system is not performing as expected. An issue has been detected in the throttle control system that connects the accelerator pedal with the throttle and integrates features such as cruise control, traction control, stability control, and pre-crash systems. If the check engine light is flashing, a misfire condition has been detected. A misfire increases vehicle emissions and could damage the emission control system on the vehicle. Please reduce vehicle speed, avoid hard accelerations, avoid steep uphill grades, and reduce any cargo loads such as a trailer. If the vehicle is continually driven with the check engine light on, the emission controls might not work as well, the vehicle fuel economy might not be as good, and the engine might not run as smoothly. This could lead to future repairs
I was driving on freeway and car went into engine power reduce mode, rapidly slowed down to 35 miles an hour.
The contact owns a 2012 chevrolet malibu. The contact stated that while driving at 60 mph, the vehicle stalled and loss motive power without warning. The contact veered to shoulder of the roadway. The contact turned the vehicle off and back on which failed to start. The vehicle was towed back to the contact's residence. The contact went to chevrolet of montebello (310 w whittier blvd, montebello, ca 90640) however, was informed that no recalls were on the vehicle. The vehicle was not diagnosed nor repaired. The manufacturer was not made aware of the failure. The failure mileage was approximately 200,031.
Vehicle is stalling out while driving, then when shuts off it will not start back up. Fuel pump was replaced, worked great for 1 whole day then did the same thing, left me stranded. Fuse box was then replaced. Ran great again until recently it stalled out in the middle of a very busy street causing me to almost be hit. Pins in the fuse box were replaced, but i'm still having issues, it seems to be related to the fusebox wiring itself, because i'm also having problems with things ran off of that fuse box! this getting ridiculous i've only had this car 4 months and it's been the worst car yet i've never had a vehicle leave me stranded. It needs to be recalled
Was driving and my car stopped accelerating. I pushed on the gas and it would not go. I was on the free way and almost had an accident. Also car would no longer start after stopped. Would act like it was going to start and does not. I've had several toes with my children in the vehicle. A huge safety concern.
2012 chevrolet malibu with horrible shifting - 1st to 2nd is a hard shift and 2nd - 3rd isn't a whole lot better. When it down shifts while coming to a stop it again shifts hard and sometimes abruptly. The rpm gauge also flares when shifting down. I have been jutted out into oncoming traffic when it decides to slip shift. I am afraid to drive this car with my family. The worst part is that the dealership cannot find anything "wrong" with it or tell me why it does this because the poor shifting is intermittent, not constant. Not happy!
Timing chain needs repair only 80,000 miles on car bought it certified used warranty is up im very upset was driving on express way engine light came on had it checked at dealership
All lights on the dash board had brake pads installed vehicle making noise while driving vehicle pulling to the right, had three sensors replaced dash board light still on05
The service engine light has been on for 3 years. Chevy has been unable to diagnose the issue despite changing out the sensors and clearing the codes. This effects the rest of the engine settings including fuel as it adjusts them based on a default. The rail support for the driver's seat has also broken loose and fallen down which makes the vehicle unsafe to drive. This seat issue was only notice earlier this year.
Engine stalls when slowing down or waiting for traffic light. Called mechanic for diagnostic check. He said ecs not functioning correctly.i was 10 miles from my home when the car started to stall and it stopped 6 times before getting home. Engine hesitated, had to pump accelerator to get it going andsteering was difficult.is there a recall for that problem?
As i was driving in in chicago interstate 94 doing about 60mph the motor just stopped running the steering was hard i had difficulty going to the sholder there was no warning lightslike if i just turned the switch to off after i got to the sholder the car just didn't want to start..i called my mechanic he said try to reboot the pc. Unplug the battery.i didthe car startedbut started with a ticking noise. In the enginei cancelled my plan turned around started to go heme 20 minutes later on the same interstate 94 the car did it again this time all the warning lights came on. But tjis time it was harder to steer the car ...can you imagine driving in the freeway with your family on board next to semi trucks and your car just stops responding.....i thing this problem should be looked at before a deadly accident happens.
The contact owns a 2012 chevrolet malibu. While driving various speeds above 40 mph, the instrument panel lighting failed to remain illuminated as the steering wheel seized. The vehicle was towed to lasorsa chevrolet buick dealer where it was diagnosed with an oil pressure valve malfunction. The dealer was also informed that the check engine indicator illuminated. The vehicle was repaired for the oil pressure valve, but the dealer failed to diagnose the instrument panel and steering wheel failures. The instrument panel and steering wheel failure recurred and the vehicle was towed back to the dealer. The diagnosis was unknown. The manufacturer was not made aware of the failures. The failure mileage was approximately 65,000.
Timing chain needed to be replaced. Vehicle has 102,000 miles on it
I have to replace my headlights every two weeks and have had to replace the plug outlet. Noticed that it is melting the plastic. This has been going on for a year now. Now it will not work it has happened on both driver and passenger side. Also have had my camshaft sensor replaced and keeps bringing up the check engine when i go get it read same code keeps going on.the camshaft issue is causing my car to stall in roadways making it dangerous for me and my daughter when in the car.
The contact owns a 2012 chevrolet malibu. The contact stated that while driving at 35 mph, there was a loud noise and the vehicle lost power as the hood collapsed and folded in two without warning. In addition, the contact stated that the engine, the headlights, and the radiator failed. The air bags deployed. The contact sustained hand, eye and neck injuries that required medical attention. The vehicle was towed to a private mechanic but was not diagnosed or repaired. The manufacturer was notified of the failure. The failure mileage was 59,000. Updated 03/24/15*lj updated 9/26/2017
I was driving and it said engine power reduced .couldn't pick up speed.
2012 malibuintermittent no start .hard crank but won't start.problem started a month ago, randomly wouldn't start had it towed to mechanic but they couldn't duplicate problem.2 days later same thing, had it towed again.started next day for mechanic.after 3rd tow it wouldn't start and they replaced fuel pump.4 days later no start again, had it towed but of course it started the 4 days mechanic had it.i picked it up and drove it all day.tried to leave in the evening and no start.it's back at the mechanics, going to replace fuss box.hopefully this works.it has never stalled while operating but it does lose power while driving and hesitates.had the vehicle towed a total of 4 times and 1500$ later car still isn't fixed.mechanic is having hard time pin pointing problem. I travel out of town on business frequently and can't depend on this vehicle.i've read multiple posts about same issue it seems chevy would try to resolve it.
The contact owns a 2012 chevrolet malibu. The contact stated that the engine overheated, stalled, and various warning indicators illuminated. The vehicle was towed to the contact's residence and was later taken to master chevrolet (3625 richland ave w, aiken, sc 29801, (806) 353-6343) for diagnostic testing and repairs. The contact stated that the dealer was unable to determine a specific cause of the failures, but stated that the vehicle was a flood vehicle. The vehicle was not repaired. The contact also mentioned that the vehicle had electrical wiring issues, the transmission failed to switch gears correctly, and the brakes had been replaced at least twice since owning the vehicle. The manufacturer was not notified of the failures. The failure mileage was 99,500.
The contact owns a 2012 chevrolet malibu. While driving various speeds, the low traction, service esc, and low engine power warning lights illuminated. In addition, the vehicle decelerated independently. The failure recurred six times. The vehicle was taken to a dealer where it was diagnosed that the throttle cover needed to be replaced. The vehicle was not repaired. The manufacturer was not notified of the failure. The approximate failure mileage was 58,000. Updated 05/11/16*lj
Vehicle has the check engine light come on and reduced power kicks in with no warning.vehicle has been driven at speed on highways when this happens and automatically slows to 40 mph.vehicle has been taken to the dealership and repairs made the first 2 times, vehicle has been taken back 3 more times for the same issue, no codes showing in the computer.issue also reported that if at a stop, vehicle has no response when you step on the gas.the dealership is currently trying to report this as a different issue so they can avoid dealing with the lemon law in the state.
I had a problem with my 2012 chevrolet malibu 2 times now in the past 2 weeks. The car begins to idle extremely rough and looses nearly all of the engine power as if it is running on 1 or 2 cylinders. The service esc , service traction and engine pwr reduced notifications display on my dash as pictured. I turned the car off and let it sit and then restarted the car to find it runs perfect and has no warning messages or symbols on. This is a very serious safety problem that gm needs to address. I searched this issue online just to find it is very common and nobody provides a fix.. I really wish that i had never purchased a gm vehicle.
This is my second incident report for the same vehicle. While driving on the highway the vehicle suddenly lost all mobility. No warning at all just stopped running. Fortunatly i was not at a very high rate of speed but was getting ready to make a turn off the highway. No indication that anything was wrong at all. My concern is why does someone need to get hurt or killed before this prolem is addressed? having taken this to be serviced i encountered others who have had the same experience with their vehicles, all chevrolets of one model or similar to it. Basically the same motor. This happened to me before and i have not been given a reason for the problem.
2012 chevrolet malibu. Consumer writes in regards to multiple safety defects with vehicle. *ldthe consumer stated the vehicle has several safety defects including the electric stability control, brakes, sensor lights, steering, suspension, wheels, engine lights, power train. Updated 10/23/2017
The contact owns a 2012 chevrolet malibu. While driving various speeds, the check engine indicator illuminated without warning. The contact took the vehicle to grismer automotive (60 n main st, springboro, oh 45066, 937-748-2050) where it was diagnosed that the catalytic converter needed to be replaced. The contact was advised by chevrolet to contact gm. The contact called gm and was informed that the vehicle was no longer under warranty due to the mileage; therefore, the contact would be responsible for the repair. The failure mileage was 103,000.
Takata recall it constantly shakes and my car is constantly pulling and random codes pop up all the time .not to mention it's a 2012 and it's rusting majorly. I am driving when my car seems to be missing a beat it wants to jerk on me like it wants to stop running. I was on a city street it happens a lot .
Misfire cyl #1 and eng lt. With misfire code, attempted chev dealer warranty repair with removal of cyl head and replacemnt valves [the cheap fix instead of replacing cyl head, in retrospect i believe chev should have replaced the cyl head for a permanent repair, now the car is out of 100k powertrain warranty] but recurrence 22k miles later.i suspect a design flaw.iternet shows many owners with same complaint.traction control light continues to come off and on.
The car seems to run fine once it starts. The problem is getting it to start. Sometimes the car starts without any problems and then sometimes it won't. It has left me stranded multiple times. We replaced the fuel pump, which seemed to fix the problem for a few days and then the same thing started to happen. We replaced a couple of fuses. Again this seemed to fix the problem for a few days and then the same thing started to happen. My husband and i noticed that there is some wiring that is always hot leading from the fuse box to the fuel pump. Basically we believe that chevrolet used cheap crappy thin wiring. Because of this, the car won't start. We did some research online and it seems that everyone who owns a 2012 chevy malibu has had a similar problem that has cost consumers hundreds of dollars. We have always owned a chevy and this is the first vehicle that we have ever had a problem with. We are seriously considering switching to toyota or nissan since chevrolet has been receiving complaints and thus far has chosen not to do anything. Chevrolet manufactured the 2012 chevy malibu and was aware of the issues surrounding the fuse box, fuel pump, and the wiring. One of these days, the car is going to catch fire because of the faulty system. It is extremely frustrating to see all of these chevy malibu owners experiencing the same issue and chevrolet does nothing. We never know if the car is going to start; it's literally a guessing game. Sometimes we tap the fuse box, sometimes we kick the side of the rear passenger door, and sometimes we have to sit and wait 15 minutes and then the car will start. Chevrolet needs to have a recall and fix the issues surrounding the 2012 chevy malibu. Eventually the wiring is going to catch fire.
Timing chain came off @ 75k miles. Called gm. They will not stand behind their product. Kept telling me to take it to a dealer. I already had it towed to a mechanic and can't afford to tow it somewhere else. Just driving down the road and the chain came off. I will never buy another chevy.
One day, driving on a freeway my car all of a sudden accelerated out of nowhere, then on the dash showed 'service esc' then immediately after 'reduced engine power' and shut off. It would not turn back on and i was on the middle of the freeway. I had to have it towed to a nearby shop while i waited for hours to get the throttle body replaced- total of $560 and my car worked for the next two days then did the same thing, this time i was on a side street so it was mostly just annoying. This has happened more times than i can count since i've had this car (for 6 months) and chevy dealerships won't do anything without charging me a ton of money and i've read hundreds of other complaints about the same exact issue i'm having online, in their testimonies, they've gotten multiple things 'fixed' because of the code that shows up, but then days later it's the same for every single one, it reverts back to the original problem. This is unacceptable of chevrolet, and i'm very upset that i personally have put so much money, not to mention everyone else that has, into a seemingly unsolvable problem, caused by a mistake on chevrolet's part. Please do something, thank you.
My vehicle fail to restart vehicle, but vehicle was running good before. Once i turn off the vehicle for couple of minutes when i returned back to my vehicle and tried to turn vehicle on it would not allow me to turn on lights on vehicle would stay on when taking key out of ignition. I kept trying couple of time until i open the hood to check battery move battery cables tried again until vehicle turn on. Once vehicle had turn on and put vehicle in reverse dashboard lights started turning on check engine a service warning message display and speed meter would go up and down. When going forward the steering wheel became hard to control while vehicle would go toward slowly then stop go fast and slowly again until i got home turn vehicle off. Didn't drive it anymore until two days later. The second time i was on the freeway when my vehicles speed started to significantly reduce speed very quickly. I became concern with my safety until i was able to pull over on the side of freeway car turned off. When trying to restart vehicle would fail to turn back on had to tow vehicle back home. I tried turning vehicle back on failed at first on the last try vehicle turned on but when putting on reverse or drive vehicle became undriveable thier was no movement on vehicle and speed meter would not move . I just purchased this vehicle only had 8 months with it i payed $5000 plus $600 on plates. I do make my vehicle available for inspection it is very dangerous going through this specially on highway. I checked my onstart vehicle report but it does not show that anything is wrong on the report. My insurance provider geico car details only show it needs and oil change. I also notice that in the vehicle history shows it has an oil leak. I can not afford to pay for a mechanic at this moment my vehicle is just park at home now.
Heater core was replaced in october 2017 due to anti-freeze leaking inside of car.the entire dashboard was removed ($1050).in october 2018, the traction control light began to appear so i had my mechanic use the gm testing equipment.two valve timing solenoids were replaced.the traction control light issue continues and when it does, the brake lights remain on.the lights only appear when driving or if the radio is on.
This is the second time this happened. I was driving on i-75 in michigan doing 75 miles an hour. Suddenly that esc service, traction control and reduced engine power display showing on the dash. The car started to shake violently. It immediately slowed itself down in heavy traffic. Barely making it off the side of the road without causing an accident. Dealership tells me there's nothing they can do about it.
The contact owns a 2012 chevrolet malibu. While driving out of the parking lot at approximately 5 mph, the vehicle shut off. The contact restarted the vehicle, but it failed again. The vehicle was taken to a local dealer who was unable to duplicate the failure. The dealer tuned up the engine and informed the contact to monitor the vehicle. The failure recurred after approximately one week. The manufacturer was not notified of the failure. The vehicle was not repaired. The failure mileage was 56,000. The vin was not provided.
The car struggles to pick up speed.the rpms go up to between 4 and 5 and it doesnt shift when it should.it struggles accelerating to go up hills.the same rpm issue happens no matter if car was just started or had been running for long time.the check engine light wont shut off.mechanic hooked it up to diagnose it, result showed it was solenoid.replaced solenoids and light remained on.reset check engine light.light came back on.hooked it up to diagnose, still reported solenoid.
While driving home one night last week, going about 60 mph, my engine cut off. I had to steer the car off the road, and started it back up. Drove another half mile or so, and the car did the same thing. This time, the car would start then immediately shut off. Car would not stay cranked for more than 1 second or so. Took car to dealership the next morning, car fixed under power train warranty. The very next , day, engine shut off while at a complete stop at a red light. Car would not start back up, had car towed to dealership. Dealership has had the car for 5 days now, still cannot figure out what the problem is. The car shutting off while driving is not the first time this has happened, every time i have reported to dealership, and they cannot fix my issue. This is a very serious matter, i have involved chevrolet customer care, and would like to hear from a gm corporate representative.
While driving car have noticed that it shifts hard either up or down. This has happened too many times to count. Also car feels like it is trying to stall and i can not accelerate. This has happened several times once on a very busy intersection in my city. Have taken car to dealer and was told could not find anything was probably bad gas and to put premium gas in. This did not help either. Car continued to have same issues. Called dealer to let them know. Said nothing wrong. I have two small children and worry about our safety each time i drive this car. Hoping that gm does something to fix this issue soon. Looks like we are not alone with this issue.
While making left hand turn engine stalled lost power for a moment then restarted several times in the last year.
The contact owns a 2012 chevrolet malibu. The contact stated that while driving 60 mph, the vehicle made an abnormal noise and the engine stalled. The contact pulled the vehicle over to the shoulder and restarted the vehicle. The problem was experienced multiple times. The vehicle has been taken to an independent mechanic who could not diagnose the failure. The vehicle was not repaired. The manufacturer has been notified of the issue. The approximate failure mileage was 58,000.
Vehicle started idling rough but ran good on the interstate or speeds above 40 mph. Checked timing chains. Chains were loose and jumped time.
While driving on the highway at 55 mph, service ecs light came on, reduced power warning light came on and car came to a full stall.
I own a 2012 chevy malibu. I bought it new 5 years ago. I have had issues with the check engine and esc lights coming on since shortly after buying the car brand new and was told by the dealership nothing was wrong. Now, 5 years later, the esc light comes on and the check engine light and the traction control light. I was told i needed a $300 throttle body, which i got, but that did not fix the problem. Six trips to 3 different gm dealers i and $1500 poorer and being told "there is nothing wrong" the car runs so badly i finally parked it in the driveway, and there it sits. There has been multiple complaints regarding this issue with chevy malibus in the 2000s. I personally know several malibu owners that have the same problems. This is dangerous because the car stalls and shuts off while driving. There should be a recall with as many complaints that has been brought forward regarding this issue. Also, while sitting at a stop sign or stop light, or as i am applying the brake to slow down, the car will continuously jerk, the engine surges and the vehicle tries to take off on its own. This is very dangerous.
I recently purchased a 2012 malibu lt, which is having the same issues, as was report;mar 26, 2019 - kaufman, tx - enginewhen driving or sitting at idle not moving service esc and traction control flashes on dash. Which is causing check engine light to stay on causing misfire on cylinder #1 and then random misfire. The car hasn+t been able to be inspected in 2 years have had at 3 chevrolet dealerships and all can+t figure out issue . The 1st dealership said we have no idea what+s wrong with the car. The second dealership said the car needed #1 injector and injector harness and throttle body which was replaced didn+t even make it off the lot and check engine and traction control and esc lights was flashing again they said might have cracked head car has been pressure tested doesn+t use water and doesn+t get hot. They are just trying to throw parts at it at my expense. The 3rd dealership which car is at now is telling me possible burnt valve causing all my issues with car said they did compression test and all cylinders have 170 pounds in all 4 cylinders which is not possible. I have replaced map sensor, pcm, spark plugs, 1 injector, injector harness, throttle body and nothing has helped car. The car never had any issues with misfire until the esc and traction control started flashing and in 2 years still has been solved at any dealership very disappointed in need of help to fix issue.how do you fix the problem? [xxx].parts of this document have been redacted to protect personally identifiable information pursuant to the freedom of information act (foia), 5 u.s.c. 552(b)(6).*cc
The contact owns a 2012 chevrolet malibu. While driving 50 mph, the contact heard an abnormal noise. The vehicle stalled and the "engine hot" warning indicator illuminated. The contact stated that the vehicle would not restart and it was towed to her home. An independent mechanic stated that the engine was not the original engine. The vehicle was not diagnosed or repaired. The manufacturer and dealer were not notified of the failure. The failure mileage was approximately 100,000.
The contact owns a 2012 chevrolet malibu. While driving 60 mph, the vehicle stalled and it took multiple attempts to restart. The vehicle was taken to an unknown dealer where the battery plug was cleaned, but the cause of the failure could not be determined. The vehicle was not diagnosed or repaired. The manufacturer was not made aware of the failure. The failure mileage was 160,000.
Timingchain causing car to misfire and engine light on
In 8/25/2014 it started when my wife want to start the car and it didn't just cranks but wont started, it did after a few tries, and then happened again the same day to my son and after a little while it started right back, and that same week i was driving about 30 miles per hr.and all of sudden it just died with no codes or check engine light displayed,it is too dangerous that happen in the middle of a main road because it didn't want to re start i have to push it across of the roadwith all this cars behind you and be afraid of being hit.it seems that it been more and more frequently happening this weekand takes longer wait to re start it, i just want to know if is a defect of this malibu 2012 i. I heard that malibu's have a issue with the antitheft system. We scanned computer history and it shows antithefthistory stored on it. Am afraid of go into expressway and run into an accident. Please help my car is a 2012 impala with 65000 miles on it.
The contact owns a 2012 chevrolet malibu. While driving 40 mph, the vehicle failed to accelerate when the accelerator pedal was depressed. The traction warning light illuminated briefly. In addition, the vehicle stalled without warning and would require multiple attempts to restart. The failure recurred intermittently. The vehicle was taken to the dealer where it was diagnosed, but the cause of the failures was not found. The vehicle was not repaired. The manufacturer was not made aware of the failures. The vin was unknown. The failure mileage was 107,000.
The contact owns a 2012 chevrolet malibu. While driving 70 mph, the vehicle experienced acceleration failure and stalled. In addition, the gear had a difficult time shifting from park into reverse or drive when attempting to move out of a parked position. The vehicle was taken to bergstrom chevrolet of madison (1345 applegate rd, madison, wi 53713, (608) 271-2212) where it was diagnosed that the body control module and an electric brake control module needed to be installed. In addition, a rear passenger side wheel speed sensor alternatorcircuit needed to be installed. The vehicle remained at the dealer since july 16, 2019 and the contact was informed that the repair would cost $2,700. The manufacturer provided a case number and referred the contact to a manager. The contact had not yet spoken with the manager. The contact was trying to find out what repairs were completed by the previous owner and was concerned that the repairs were not done properly. The dealer could not provide a service repair history for the vehicle. The failure mileage was unknown.
Driving into town, alerted by pedestrian that my car was on fire underneath. Everything failed, while i tried to pull off the roadway. Had to kick out the window to get out. When i barely got out, the entire car was in full blaze.
"takata recall"if i hit a bump small or any size actually my engine reduces and i have to pull over...and turn the car off for up to 10 mins sometimes...i cant drive on the freeway at all because i dont want the engine to reduce while doing 60 mphlately it will go into engine power reduce while im parked in a driveway so i dont get it
The contact owns a 2012 chevrolet malibu. While driving at various speeds, the engine stalled without warning intermittently. The vehicle was taken to a dealer, but it was not diagnosed or repaired. The manufacturer was notified of the failure. The vin was unavailable. The approximate failure mileage was 46,994.
My car had had the heads replaced in the first motor it came with then the whole motor replaced before 100k miles now the new motor doesnt barely have 100k miles on it and they are telling me my cylinder 6 isnt holding compression so i'll need another motor eventually! my transmission is leaking , its had a whole new air conditioning unit installed when my motor was replaced because it went out. The speakers on my passenger side dont work and my heating system on my seat on the driver side has went out!
Engine losses power shuts off wont restat
My vehicle has 86,200 miles on it and i have to have both heads rebuilt because of a burnt exhaust valve.i have been told multiple times that this should not be happening at this low mileage on the vehicle.the engine idles really rough when in park or not in drive or motion.when stopped at a stop light, the "service traction, service esc, esc off" comes on.this goes away once you start driving again.
At first the car would not turn over when trying to start, happened when using key in ignition as well as using the remote starter, this was random.would run fine for days, sometimes for a week, then it won't start. Also as the weeks went by while idling at a red light, the car just quits running, couldn't get it started, after several tries, it starts (thankfully). Also happened while in park, car just stops.also while driving on the interstate the car all of a sudden will not accelerate, press on gas pedal...nothing.until today after a few seconds and the car suddenly starts to accelerate.engine light came on few weeks ago, stated it was the cam shaft position sensor ($120.00), therefore we replaced both sensors. No change!oh we also replaced the fuel injector sensor in the back.husband read someone else had the same problem and he recommended hitting the box in the trunk (where the fuel sensor is, etc) and your car will start up.sure enough, the next time my car wouldn't start, i hit that box a few times, and car started.
The contact owns a 2012 chevrolet malibu. The contact stated that the exhaust manifold cracked in half and caused exhaust fumes to enter the vehicle. The contact replaced the exhaust manifold himself. The dealer and manufacturer were not contacted. The vehicle was repaired. The approximate failure mileage was 100,000.
The contact owns a 2012 chevrolet malibu. The contact stated that the steering wheel abruptly locked while attempting to turn at a low speed. The failure was experienced several times. While the bluetooth was in use, the radio and steering wheel simultaneously failed. The vehicle was taken to the dealer where it was diagnosed that the battery cable was defective and caused the electrical system to lose charge. The vehicle was repaired. The battery cables were replaced and routed correctly. The manufacturer stated that the cable failure was due to wear and tear. The failure mileage was 47,607.updated 09/20/16*lj*as
My low beam passenger and driver headlight goes out every 2 to three months. I have changed more headlight bulbs as much as oil changes. Below is a link listing many other consumers with the same problem. The repair can cost up to $200 at the shop. I've almost been given a ticket, but luckily i was leaving autozone with my light and reciept when i got stopped. This happens without warning. Many people with the same car has fixed the harness and still have the same issue. Please help us get this resolved to keep safety and visibility on the streets and to prevent unneccessary tickets for hard working people. Here is the forum link. Thanks. Https://www.cargurus.com/cars/discussion-t32066_ds667897 this issue seems to happen randomly. One day i turn the car on and it's just off. There have also been police chevy's driving around with one headlight light on.
The passenger low-beam light has an issue. I'm not alone, thousands of other chevy malibu drivers have all reported the exact same issue. The wiring harness that connects to the low-beam bulb keeps over-heating and melting, causing the bulb to go out. I have replaced the pigtail three times now, and it keeps going out. I have even pulled the drl fuse, which many believe could have been the problem, and it still keeps happening. Please issue a recall for this issue as i am not alone.
The contact owns a 2012 chevrolet malibu. The contact stated that the headlight connectors were melted and had to be replaced 7 times within the past three months. The vehicle was taken to an independent mechanic where the contact was informed that there was too much volts going to the headlight wiring connectors causing the connectors to melt. The vehicle was taken to van chevrolet (100 nw vivion rd, kansas city, mo 64118, 816-527-8564) to be repaired. The vehicle was repaired however, a week later the failure recurred. The vehicle was not repaired. The contact emailed the manufacturer and received a response which stated that they were aware of the failure however, no additional assistance was provided. The approximate failure mileage was 140,000.
The headlights keep going out i have replaced the bulbs and connectors several times and they are currently out again for the 8th time
Takata recall. Passenger headlight has been change 6 times and continues to go out.i was told my wires were fine. I can't seem to find the problem.
Vehicle would not start. Dealership changed fuse box and wiring in trunk due to melting. Now low beam headlights not working. Replaced one months ago, now both not working again. Noticed similar complaints on your website.
Passenger side low beam needs to be replaced every year. Sometimes sooner. The passenger side low beam connector melted.
Driver side headlight malfunctioning multiple times in past year. Head light will go out, at first could tap on head light and it would come back on. Have changed pigtail and bulbs only to have it work for a short period of time.
The interior light panel went completely dark, after a few minutes it lit up again.this has been happening more frequently lately. The radio stops playing and the panel reads"auxiliary mode".i have to turn the radio off and on for it to start playing again.it is happening more frequently. When i plug in my auxiliary cord to listen to my ipod, it shorts out.the clicker to unlock/lock the car stopped working so i went to get a new battery. They tested the battery and said it was fine.my rear defroster does not work at all.
Passenger low beam light keeps going out have replaced 3 time works for a couple days then goes out again. Very costly when you have to take whole bumper off to replace. Have seen many other complaints on malibu's with same issues.
Ive had to drop the car of 8 times now to try and repair the right front headlight which keeps going out. Pigtails connectors and bulb all replaced multiple times now.
The passenger side low beam light keeps going out. I've changed it 4 times in less than 2 years.
The right headlight keeps going out. I have changed the bulb 6 times in two weeks. I have changed the plug and it still keeps going out. It is the low beam light bulb that malfunctions. I have changed the switch for the lights and also took it to a car shop. Nothing is fixing it.
The plug to the left headlight continues to melt and short the headlight out. It is not the bulb, but the plug in system for the headlights.
Passenger low beam constantly going out, for a while both low beams would go out then come back on.
2012 chevrolet malibu.consumer writes in regards to body control module recall notice.the consumer stated while driving, the airbag deployed and caused him to have an accident. The consumer was injured.the consumer sent in a recall notice along with his complaint.
Takata recallwhen i'm driving my vehicle, the headlights flicker as if i'm the police. I took it to firestone and they told me to take it to a dealer the car only has 160,000+ and it just startedevery time i accelerate or drive it does this and i'm afraid that i will either get pulled over by the police, hit someone or someone hits me or/and the lights go completely out while driving at night. Is this due because whenever you have to change the build, the whole bumper has to come off to replace it? i like my car but this is a serious issue that needs to be addressed. I see a lot of complaints regarding this
Left low beam keeps going out and bulb not burnt out. Replaced 3x in the passed year
Replaced low beam lights multiple times, had the wiring harness replaced due to a shortage that was supposedly leading to the low beams light blowing out constantly. Low beam lights still keep going out. Ongoing issue
Do not remember when i brought my car in for campaign 14v252000 maybe approx. A year ago. The problems the car was having before i had the recall done have started again. Up until now haven't had any problems. My dealer wants to charge me to fix it.
Passenger side headlight( low beam)continues to go out after being replaced several times in a short amount of time, 2-3 weeks.
I have a 2012 chevy malibu. Thus is my everyday vehicle and when i have headlight problems it is very frustrating. We have had the bumper off this car multiple times which is a real pain. We have changed headlights, wiring harness and even undoing the battery. The passenger light comes on for a bit them will go off and not come back on. I have a loan on this car and can't even get rid of it cause i can't keep the lights on. Worse chevy car i have ever owned. I have been pulled over for it being out and how am i supposed to explain it. Reading the reviews of this car online i am not the only person that has headlight problems.
Passenger side low beam headlight connection between bulb and harness keeps melting causing headlight to not turn on. Have changed out wiring harness many, many times in a year.
Low beams both headlights repeatedly go out. Heater/air conditioner turns off and on by itself. Motor has been changed and tested. Is there a wiring problem with this vehicle across the board. I read a lot of people with this vehicle have the exact same issues. Heater/air turns off while in park or drive randomly.
For months i been dealing with my low beams and high beamsnot working on my passenger side then one day the high beam work for a few minutes i have gotten pulled over by the police, i have changed the bulbs, i have took it to midas to get it checked out and they couldn't figure out the issue. I'm taking it to another mechanic tomorrow. I see i'm not the only one having this issue
Driver side low beam headlight keeps going out. Replaced 2x in less than 90 days, still not working. Light works just before the new bulb clicks into place in the connector, but then as soon as the connector clicks in place, the bulb goes out. Has happened multiple times, same thing. No other issues with lights, turn signals, hazards, etc...only the driver side low beam headlight. Happens regardless of whether or not vehicle is in motion.
Repeatedly fixing low beam headlight. Passenger side first now both low beam headlights.switched to low beam on secondary road to have no lights. Pitch dark.
My low beam headlight goes out unexpectedly i have changed it already and now its out again..im not the only malibu owner with this problem. So i think someone with chevrolet needs to find an answer for their car owners for a recall solution..please don't want to have to trade my malibu in because of a headlight issue but everytime a new bulb gets put in it works for a limited time and then i am driving around with one headlight!
Low beam headlight going out. I purchased this vehicle in 2014 and my low beam headlights have gone out a total of 6 times.changed the pigtails last time and iam now having to change the wiring harness completely and hopefully that will help. My cars lights are always on auto and always begins with my passanger low beam light going out first then the driver side a couple months after, has happened when turning on the vehicle and during driving.my high beams work fine with no problems at all.the first two times i have had a proffesional mechanic change them and the last couple times i've changed them myself now due to cost.removing the whole bumper really makes this even more difficult to change.i have read many forums and they have also the same problem, its actually become very common to see many chevy's with a head light out.i just want to make sure this is noted cause it appears to be a common problem with this vehicle company. Please help!
Recently purchased 2012 chevy malibu july 13, 2019. Two weeks after purchase the passenger headlight went out.changed it, and now its out again 5 weeks later.this seems to be a common problem with these cars.i have found online many people complaining of the very same problem. (passenger headlight)some say to change the wiring harness as they seem to get overloaded and melt (but that fix doesn't last long either from what i read) others say the daytime running light relay causes an issue and should be taken out of the car.it says in the owner's manual that drl reduces the light output of the headlights for daytime running by 30%.this seems to be what is causing the amp draw for the low beams to skyrocket in drl relay.the massive amp draw is too much for the terminals in the plug, so they get super hot and melt the plastic plug.the metal terminals relax from the heat and stop making good contact,which worsens the amp draw problem causing the light to not work. ( but not necessarily due to the bulb burning out, as some have posted they put the passenger bulb in drivers side and the bulb still works)this issue could potentially be very dangerous especially at night if both headlights go out at the same time due to the amp surge. I believe this is a design flaw. I don't know how many complaints you have to receive for this to be considered a safety recall but please consider it!thanks
On two occassions the power steering suddenly went completely out while on the highway. Since i got the car 2 years ago i have had many issues with the lighting amd electrical.the brake light works when it chooses to even if k done push the brake and with new bulbs it may not work. The headlights do the same. They come on and go off when they choose to. I have replaced bulbs over 20 times in the past 2 years when i didn't actually have to. My sensors also don't work which i was told was an electrical issue. I have a front light that won't go off so each time i cut the car off i have to unplug my battery so it doesn't die. The date posted isnt the only date its happened it was the day it all started.
The contact owns a 2012 chevrolet malibu. While operating the vehicle, the low beam headlights suddenly shut off. The vehicle was taken to an independent mechanic who diagnosed that the wiring harness melted. The failure occurred on both the driver and passenger sides. The manufacturer was notified of the failure. The failure mileage was 90,000.
This is the fourth time i am put in a new head light on this driver side . I have also change the wiring on both side . The wiring keep burning out . Have to change the wiring on the drivers side again burned out again. These bulb are $ 21.00 each title of $ 80.00 pluse wiring at $18.00 each =$ 36.00. All this in 3 months . This is crazy. I am on a fixed income . Please tell me this is on the recall list . I can not keep putting lights and wiring in this car . I have to finish paying for it as well. Recall no. Is 13036.
I've changed my passenger side low beam headlight 3 times and it keeps going out. I've had this done 3 times since september 2020. Also, my lock and unlock buttons do not work, except for on the passenger side, only the unlock side of the button works. I've had this car since september or october i believe of 2018. It's very frustrating and i've waisted over $500 getting it replaced.
Tamara recall my low beams lights keep going out and on, it does this when park, and driving they work sometimes one or the other sometimes they won’t come on at all.
The contact owns a 2012 chevrolet malibu. The contact stated that the vehicle would not start and the air bag and check engine warning indicators illuminated. The contact stated that the failures occurred on different occasions. The vehicle was taken to cox chevrolet (2900 cortez rd w, bradenton, fl 34207,(941) 348-6417), but the cause of the failures could not be determined. The contact stated that the dealer made unknown repairs to the vehicle, but the warning indicators remained illuminated. The contact also mentioned that the vehicle was taken to a local tire shop for the replacement of the exterior lighting. The contact stated that every three months a different exterior light would go out and had to be replaced. The vehicle was not repaired. The manufacturer was made aware of the failures. The failure mileage was unknown.
The interior light panel went completely dark, after a few minutes it lit up again. This has been happening more frequently lately. The radio stops playing and the panel reads "auxillary mode"and then back to radio, then back to "auxillary mode". I have to turn the radio off and on for it to start playing again. It is happening more frequently. When i plug in my auxillary cord to listen to my ipod, it shorts out. The clicker to unlock/lock the car stopped working as well, so i went to get a new batery. They tested the battery and said it was fine. Also my rear defroster does not work at all now.
The contact owns a 2012 chevrolet malibu. The contact had the vehicle repaired under nhtsa campaign number: 14v252000 (electrical system, electronic stability control, exterior lighting, service brakes, hydraulic, vehicle speed control); however, the failure recurred. While driving approximately 45 mph, the traction control warning indicator illuminated. The vehicle was taken to a dealer where it was diagnosed that the bcm module needed to be replaced. The vehicle was not repaired. The manufacturer was notified of the failure. The approximate failure mileage was 22,000.updated 02/12/16*ljthe consumer has since sold the vehicle. Updated 02/22/16.
This is the fourth time my passenger low beam has went out the third time i changed the low beam wiring and in less than a month it has gone out again something is not right i have heard many people complain about the passenger low beam keeps going out something needs to be done asap
Head lights keep going out
I brought my vehicle into a chevrolet center near me to have a 'manufacturers warranty fix' done to my vehicle on 04/17/2021, as the power steering had failed and i was able to get this fixed for free. When i turned my vehicle on and noticed the power steering notification on my dash, i tried to back my car out of where i was parked and move my wheel, but could not move the wheel. When the part was replaced, i was told that there were still sensors on my dash indicating that i needed the esc and stability traction control serviced for my car. According to the chevrolet dealership, this had 'nothing to do with the special policy fix' and not something they would be fixing for me. After checking the nhtsa.gov for any recalls on my 2012 chevy malibu, i found one from may 2014 that described exactly the problem i was having with my vehicle: loss of vehicle stability traction control, cruise control and random illumination of brake lights. I contacted chevy once again about this recall, to which they said there 'was no recall for the vehicle, and if there was it was already fixed'. Not only was this completely unprofessional and lacking concern of safety for my child and i, i do not know where to turn to for this to be remedied. Attached is the ticket for the initial fix i had done.
Both low beam headlights go out too often. The lights are not burned out because they'll work for a few weeks and will not work for months at a time; individually or simultaneously. The passenger harness and bulb was replaced at winter chevy in pittsburg ca in 2018 and went out again a few months later.the low beam lights have been a consistent problem since i purchased the used car in 2015. Both low beam lights had bulb replacements 3 times each. Both low beam headlights have been out for months.
This will be my 5th attempt with changing the passenger side low-bean. I recently took again to my mechanic on january 7, 2019 to replace the bulb and exactly january 24 it went back out again. This issue need to be reported and to be recall. This issue will keep happening over and over and its obviously not the bulb is the problem. I got pulled over and was issued a repair order by the police on another bulb issue and then another a ticket even when i had showed police i had brought a blub to replaced it. This is beyond frustrating plus to removed the front bumper to replace the bulb creates an extra charges.
Headlamps constantly burning out fuzes blown dangerous when lights go out at night. Safety hazard.
The low beam headlights on both sides of the car are constantly going out.i have to replace them 3-4 times a year.i spend hundreds of dollars onheadlamps, even though i install them myself.installing new headlamps requires you to remove the front bumper.there is an obvious design flaw with the hundreds of complaints i have seen with this same issue.
Passenger low beam headlight keeps failing every couple of months this is a big problem with all chevy malibus. Driver seat back breaks and causes the seat to be unsafe.
My headlights keep going out, my car will not align and the electrical plug will not work
Passenger low beam headlight burned out 6 times and had to be replaced each time. Driver's side low beam burned out twice and replaced each time. Both headlights were replaced every time one went out. This was done to be safe as it is difficult and time consuming to replace. Currently driver's side is very dim and passenger side is out again and vehicle cannot be driven at night. Lights have gone out at random times and have caused very poor night vision. Luckily no accidents, but have been pulled over twice because of the issue. A couple incidents the headlights would go onand off when hit bumps in road. I read many reviews and believe this is a very common issue, gm is aware of theproblem and has not recalled the vehicles to fix it.
The contact owns a 2012 chevrolet malibu. The contact stated that while driving at an unknown speed, the brake lights failed causing another vehicle to crash into the rear end of the contact's vehicle. A police report was filed and no injuries were sustained. The vehicle was destroyed. After the crash, the contact received a notification for recall nhtsa campaign number: 14v252000 (electrical system, electronic stability control, exterior lighting, service brakes, hydraulic, vehicle speed control). The manufacturer was made aware of the failure. The failure mileage was 58,000.
At 1st my car wouldn't crank every so often then started going drag while driving i googled it and had to beat on fusebox in trunk or wiggle wires so had to run wire straight to battery to fuel pump. My headlights on dim keep shooting and my speakers will go out sometimes
I have changed my passenger headlight 3 times and pigtail once and it still keeps going out called chevy they know its a common problem but can't do anything about it unless i pay not fair to the consumer
Is having to constantly replace low beam headlight. My headlights have both went out 3 times within 6 months. This is very costly repair because the front bumper has to be removed in order to get to the headlight.
Three times in two months the passenger low beam has gone out. I work nights and each time it has gone out it has been while i am driving to work in the dark. I have researched the issue and no clear answer has been given on how to fix the issue.
Passenger side headlight (low beam) has had to be replaced 4 times in the last 2 years.
First my passenger side headlight went out so i replaced the bulb and the next day it wasn't working again. Now my driver side headlight is also going in and out without the bulbs burning out. The lights have gone out while riding and while stationary, sometime there on when i park the car and off when i crank it back up again.
My headlights have been replaced 3 times in the past 2 years (twice in the past 6 months). I am a single mom and cannot afford to continuously pay $180 to have bulbs replaced. I have to take it to a mechanic shop because the front bumper has to be removed. This last time, the left low beam light, would go on and off and then it just finally went out. It did not matter if i was sitting still or if the car was in motion, however, i did notice it happened more when i would hit bumps. It is almost like their is a loose wire somewhere.this vehicle needs to be recalled to fix the faulty issues that myself and others are having.
Low beam lights continuously going out. Bulb is still good. Have replaced bulb. Took the vehicle to the chevy dealership. They replaced some wiring or harness. Now passwnger side low beam is out again!
Driver side headlight kept going in and out until completely going out and not working. When getting a new bulb put it it did the same thing a week later. The wiring in the headlight is faulty. The same thing goes for the front speakers of the car. The front speakers will come on and off on their own as well.
Headlights burn out repeatedly! happens randomly, on either side after car has been off.i am averaging 1 to 6 months after a headlight change, it is very costly on this model since the whole front bumper cover must be removed to change a bulb.
Low beam on passenger side goes out frequently and randomly. I thought it was just my luck. However according to https://www.cargurus.com/cars/discussion-t32066_ds667897 there are a lot of people with the same issue. Ive been lucky enough to keep getting stop by nice cops, but this is getting bad. I have a 1year old that i cant take out in the car because it isnt safe. For who knows what reason. Please help.
Low beams are to low for night time driving can they be adjusted? can't see very far so have to usebrights very dangerous for oncoming traffic also.also the interior lights, instrument lights, get real dim either driving or stopped, so dim gauges are hard to read. After a while they come back on.
Driver side headlamps going out.i've had to replace my driver's side headlight 3 times over the last 2 months.no automobile should go through headlamps at that rate.to complicate this issue, the entire front bumper must be removed to change the headlights.i've read on the forums where many malibu owners are having the exact same issue(s) with the headlamps.this is an obvious design flaw and gm/chevrolet should issue a recall with corrective action.
Passenger side low beam goes out every couple days to 2 weeks. Bulb and wire harness has been replaced and only corrected the issue for a short time.
The passenger low-beam head light goes out. If i go over a bump it sometimes comes back on. Went to get light changed and same problem started a week or 2 later. Now both low beam lights have gone out. All other lights work fine. This happens at any time, stationary or in motion.
My 2012 chevy malibu passenger side low beam has gone out for the second time in less than a year. After doing some research, i found this is a common issue for the chevy malibu. Entries stating similar issues specifically effecting the same passenger side low beam, totaled more than 300 on carproblemzoo.com this is not only a monetary issue, not only a resource issue, but a significant risk to operator and bystander safety.if gm does not acknowledge they have supplied a faulty product, as described by the hundreds of complaints listed online, they are complicit to any accidents or injury caused by their lack of action and concern. My own experience has been frightening, noticing a lack of power after i'm already on the road,only seeing one light from my car reflecting on another car or surface. The general public takes great care to make sure their vehicles can both safely operate and transport themselves and others. With this damaged part in chevy's malibu, making great strides for a safe vehicle could be for nothing if the light does not do its job. With this in mind, please consider the climate we live in today. The difference between a faulty headlight, and a reliable light, could mean life or death not only for those on the road, but for poc, targeted by police, for a faulty headlight. In 2015, darrius stewart was a passenger in a 2009 chevy malibu. He unjustly lost his life to a police officer after the driver was pulled over for what do you ask? a headlight out. Darrius stewart. General motors- recall. Http://chng.it/rpxwymbw9v
The contact owns a 2012 chevrolet malibu. The contact received a notification for nhtsa campaign number: 14v252000 (electrical system, electronic stability control, exterior lighting, service brakes, hydraulic, vehicle speed control). However, the part needed was not available. The dealer indicated that it would take months before an appointment could be scheduled. The manufacturer was contacted and could not provide an estimated date for when the vehicle would receive the recall repair. The contact did not experience a failure.
The center brake light doesn't work. I put in a new led light assembly in and it still doesn't work.
Pulling out of a parking space, all of a sudden my steering wheel does a quick jerk, my traction light luminates and then service esc comes up on the display and then power steering shows on the display and at that point iost power steering assist and at this point i could not turn the wheel at all, i had no control over the car at this point.i put the car in park, turned it off for several minutes and then turned it back on and power steering was back.this is unexceptable...what if i had been on the free way going 70 miles per hour and lost power steering.this very issue was a recall on the recalling certain model year 2004-2006 and 2008-2009 chevrolet malibu(s) and obviously it is still an issue with the 2012 model.i have had no issues with steering prior to ths day it happened 10/30/16 and no warring power steering assist was going to fail.fix it once and for all gm. Do your customers have to be seriously injured or worse in order for you to get this right!!!!now we have to find the power steering unit and get it fixed because my car is literally a death trap.also, the interior lights (dome) and headlights start flickering after 10 mins to 60 mins into my drive like there is an electrical issue. Also, the rear defrost stopped working and i can't see out the rear window, i have to drive with the windows down to try and hurry the process along and that is not fun when it is freezing out side!
I have changed my passenger headlight bulb several times and it still does not work every time i have to fix it i am charged $100.00 or more. Also i have had to change the motor to my drivers side window twice. This also also happened to my 2000 chevy malibu. It seams like this model has many issues.
I've replaced low beam headlight bulbs 4 times (3 on passenger side) the past 13 months; the high beams 3 times (2 on passenger side). Had to run on high beams only for approx 2 months cause both low beams went out a couple of months after replacing them. Been buying the higher end bulbs and been careful to not touch them. Had to replace yet other bulb tonight cause high beam went out. Replaced 1 high beam and 2 low beams and the passenger side low beam went out on the way home about 15 miles.
The contact owns a 2012 chevrolet malibu. The contact stated that the headlights failed. The contact took the vehicle to the dealer who diagnosed that the light socket needed to be replaced. The vehicle repaired however the failure recurred. The failure mileage was 88,000. The manufacturer was not notified of the failure. Vin tool confirms parts not available.
The low beam light on the passenger side keeps going out i've changed it twice and its still going out as if there is a shortage
I have a 2012 chevy malibu i bought it in 2014. I have had the esc light come on in 2016 but no problem with it untill now of this year in 2022. Not knowing the problem i have already put alot into it. I took it to a machanic they told me it was the rack and pinion. So got that done . Apparently it wasn't it took it to another machanic they told me it was struts got that done too n still nothing so i looked it up online got cv joint, inner ,tie rod, wheel alignment. All those done n still nothing fix it. I didn't know what else to do until i made more scratch on my vehicle and i found that it could be a recall .
My dim headlight keepsburning out and i kept having to change my bulbs. To come to find out it was my wiring harness and i've had to change it twice. My bright lights do good. It's just the dim lights. Please recall this. It's a headache trying to fix this problem once or twice a month. I've also read that several other people's chevy malibus headlights are messing up too. Everytime i pass a malibu one of the headlights are burned out. Please fix this problem. Thank you.
Headlights continue to burn out regularly (requiring replacement of bults multiple times per year) and the wiring harness continues to melt. Because of the design of the car, the whole front bumper has to be pulled off to get access to light to replace--often at a high cost at the repair shop. This is unsafe,as the frequency of the burnouts result in having to drive with brights on at night when both lights unexpectedly go out. Reading the manual, the drl reduces the voltage to the low beams, which drives up the amps causing the extra heat to melt the wiring harness. This is a design flaw that needs to be remediated by a recall.
Front headlight will go out like it is burned out - but then randomlyturn on later - change the bulb and it will work for a few days then shut off
The passenger side headlight keeps going out i'm changing these out every couple months i've researched and found several other drivers are having this same issue
The contact owns a 2012 chevrolet malibu. The contact stated that the low beam headlights failed to operate every three months. The vehicle was taken to valenti auto sales (399 n colony st, wallingford, ct 06492, 203-774-4035) where it was diagnosed, but no failure could be found. The vehicle was not repaired. The manufacturer was not notified of the failure. The failure mileage was approximately 120,000.
Main headlights continually stop working. Wiring issue as headlight harness burns out. Headlights not burning out. Have replaced harnesses twice in a year with factory harness from chevy dealership, and same problem both times. Out again. Have to drive with high beams only. See this link for others with same problem! so frustrating and dangerous. We need a recall!!https://www.cargurus.com/cars/discussion-t32066_ds667897this vehicle is not easy to replace headlights or harness as entire front bumper must be removed, and i have had to do it 3 times in a year since i bought, and have to do again. Please please please do something. Thank you.glen
Fuse 6 blows when left turn signal is activated.it first blew in oct 2018, then not again until december (several times) and still happening again in jan 2019. Signals will work fine for a day or two after replacing fuse, but then fuse blows again.
The contact owns a 2012 chevrolet malibu. While driving various speeds, the headlights failed to illuminate and the service engine warning indicator illuminated. The vehicle was taken to an independent mechanic who diagnosed that there was an electrical failure. The vehicle was not repaired. The manufacturer was not made aware of the failure. The failure mileage was approximately 62,000.
Power steering, lights, electrical stability, engine, transmission
The low beam headlights will stop working, but the bulbs are still good.this has happened while i was driving.both lights do not work and replacing the bulb does not fix the problem.
The contact owns a 2012 chevrolet malibu. While operating the vehicle, the driver side headlight shut off. The failure occurred several times and the headlight bulb was replaced on several different occasions. The vehicle was taken to an independent mechanic, but the cause of the failure could not be determined. The manufacturer and local dealer were not notified. The vin was not available. The failure mileage was 25,000.
My headlight keeps going out i had the bulb replaced and electrical sockets and it keeps going out this is the 4th time i have had to have the same work completed.
The headlights have continuously shorted out. I have changed the headlights 3 times in a 3 week span and they keep going out. I have replaced fuses as well. The traction on the car is constantly slowing down. The esc light comes on. The car slows down on all streets and it has done so on the highway.
The front passenger side low beam light keeps going out. I changed the light about 3 months ago and it's out again. No bumps, accidents, nothing. Its just goes out.
Low beam head lights go out every month. Bulbs and pigtails have been replaced multiple times but they keep going out. I'm am unaware that they are out until i'm driving at night or pulled over by police and told that it's out. They seem to alternate, one goes out, i get it repaired and then the other goes out.
The contact owns a 2012 chevrolet malibu. The contact stated that the vehicle's low beam headlamps failed to operate. Jeff wyler springfield chevrolet (2237 w first street, springfield, oh) diagnosed that the wiring harness had melted and recommended it be replaced. The vehicle was not repaired. The manufacturer was notified and did not assist. The failure mileage was 93,000.
I keep having to change my headlights on both sides way too frequently and it's way too expensive to keep replacing them it has got to be something wrong here!!!!
Headlamps keep going out within months after service, lightbulb seems to have blown but then comes back on later. Harness replacement 2 times in 2 years, plastic connectors keep melting or heating. Bulb blown also one hour after leaving dealership servicing. Multiple dates of incident with most recent 1/29/2020
Since september of 2014, the low beam headlights on my malibu have repeatedly gone out. The latest two incidents in march 2015 (passenger side) and june 2015 (drivers side) have resulted in the socket burning out. There is a forum where many drivers have noted this same issue. I was told it sounds like there is an electrical issue with the harness and that it is a very serious issue and could lead to a very bad situation. I've called and complained to chevy but they claim that they have no prior complaints which i find hard to believe. This is a very expensive issue because of how they have constructed the vehicle. Please force them to fix this issue.
The passenger side low beam light burns out or stops working frequently. It has been changed more than three times. Recently, it was changed on february 17, 2018 and stopped working on february 25, 2018.
Both low beam headlights (front left and front right) stopped working at the same time. This occurred when i was driving with a passenger away from home at night in the dark.
Both headlight go out. Replaced the bulb 5 times last year and 1 time this year. If i am driving my car and hit a bump the light will turn off or if it is off it will turn on.
On approximately wednesday 2/20/2019 and at 3 points in 2018 a headlight went out on my 2012 chevy malibu. On 2/24/18 i received a ticket for it. But the only reason i did and the 0nly reason a key safety feature was disabled for so long is due to a design flaw by chevy. You have to remove approx 30 bolts and the entire front clip of the vehicle to change a headlight. This design flaw not only disenfranchises people but also makes the road less safe due to the fact the average non mechanically inclined person would likely go to a mechanic and usually wait to do that because of the costs. I think rather than fine them. Issue a recall for the tickets people have gotten because of them in addition to making them offer free service on headlight changes. Maybe they won't do stupid stuff that endangers the road again if they have to pay every single petty little ticket.
Headlamp harness keeps burning causing headlamp to fail to illuminate.have replaced multiple bulbs as well as both harnesses within the last 6 months and again, harness has burnt and my low beam headlamps do not work.reading similar complaints, i believe it has to do with the daytime running light feature.i've noticed the issue both when the vehicle is moving and when it's stationary.while there hasn't been a fire as a result of this issue yet, i'm sure it's just a matter of time.
Passenger low beam headlight continually burns out. Have changed bulb multiple times. The last time the bulb literally blew up. The new bulb would last an hour or a day or two.
Headlights and high beams keep going out got the changed 6 times in less than 4 months came back on one time when i had the anti theft problem and had to jump my car but then back to being out again
Right low beam keeps burning out twice driving on a city street and repaired by a chev dealer twicewent out setting in garage and replaced by a certified auto shop
My passenger side lowbeam. Headlight keeps going out now i got pulled over and need to take my car into the mecanic shop. For what i was told is atleast 200 dollars. Right after the hoidays. My 1997 chevy silverado hasn't needed a headlight replacementin 6 years but this car i changed the bulb 4 times last year? not to mention its so hard to even get to the bulb you have to take into the shop.
I have replaced my low beams 3 times this year. The first time i reaplaced all the bulbs. The second time i reaplaced both wiring harness and bulbs. A month ago i replaced the passenger bulb and now the drivers side low beam is out again. It has cost me anywhere from $100-$200 each time to do this! i also have a problem with my dash telling me service esc, esc off, and service traction. A recall in 2014 addresses this issue and my vin says the recall has been serviced but i am still having this issue. It happens with the car in park and while driving. Sometimes it stays on for hours sometimes minutes.
Vehicle high mount third brake light failure after 60,000 miles. May affect visibility when stopping.
Low beam headlights keep going out. This is sept 18 and i've replaced the right side 4 times this year and the left 2 times. At the moment the left is out. I've contacted the dealership and the diagnostic charge is $130. The only thing about it is paying $130 to tell me what's wrong and going in blind not knowing how much it will cost to repair. I've been watching to see if there will be a recall issued on this. I love my car and don't want to have to get rid of it. It's paid for and i only have $118k miles. Thank you
In less then one year the passenger side low beam light is out. I look on line and a lot of 2012 malibu are having the same problem. It cost over $100 to change it because they have to remove the bumper to do it.
My passenger headlight wiring harness has a short in the wiring or from the headlight bulb to the short wiring harness to the main wiring harness. I sent general motors a message. They want me to pay for it. It is a factory fault. I only get social security for my funds.
Car will shut down. Head lights stop working less then every two months. Fuse inside the car where to charge the phone isn't working both front and middle. Car dies randomly after being left on for a little while. Hot and cold rate stays on cold all day and has the ac unit blow out cold air when on heat and if on cold it just blows air. Car wont drive faster then 5 mph after having the batery rebooted depending on if te car was allowed to sit idol or a while. Car will place it's self in shut down de to elecrical problems. Once one starts acting up they all start acting up.
The contact owns a 2012 chevrolet malibu. The contact stated that the driver's side low beam headlights failed to illuminate intermittently. The vehicle was not taken to a dealer to be diagnosed or repaired. The manufacturer was notified of the failure. The failure mileage was approximately 170,000.
Warning on dashboard service traction control when applying the brakes. Brake lights does not come on when the service traction control come on. There has been a recall on this issue previously and issue still occurring.
The passenger low beam keeps going out its not the bulb i've changed it atleast 4 unless this year yet it stills goes out and everybody else has the same problem on same side of the same car. There needs to be a recall for this.
The low beam and running lights on driver's side keep going out the wiring harness and bulb has been changed 5 times now and still goes out ever other week . And to top it off this car has the most rediculous way to get at the headlights. So time consuming
Passenger side headlight intermittently goes out for no apparent reason. The vehicle could be stationary or in motion and it does not matter. Sometimes the light will go out and back on when moving over a bumpy road.
Misfire cyl #1 and eng lt. With misfire code, attempted chev dealer warranty repair with removal of cyl head and replacemnt valves [the cheap fix instead of replacing cyl head, in retrospect i believe chev should have replaced the cyl head for a permanent repair, now the car is out of 100k powertrain warranty] but recurrence 22k miles later.i suspect a design flaw.iternet shows many owners with same complaint.traction control light continues to come off and on.
Passenger head light has been replaced several times it keeps turning off. Light bulb is not burned. When taping on or moving wires light goes on replaced wires and still having same issue. Vehicle can not be driven at night time. All this happens when vehicle is turned on.
The passenger side low beam light bulb socket keeps burning out. Replaced the bulb 3 times in one year. The socket is the problem, keeps shorting out. When i replace the bulb the socket where the bulb plugs in to is burnt and melted.
The contact owns a 2012 chevrolet malibu. While driving at various speeds, the low beam headlights failed. The vehicle was taken to an independent mechanic where it was diagnosed that the low beam headlights melted the halogen connectors. The vehicle was repaired. The manufacturer was made aware of the failure. The approximate failure mileage was 10,000.
Water inside headlights. Right headlight assembly replaced 6 months ago, now have water inside left headlight, dims the light, will have to replace, will be serviced 12-17-15. I have noticed quite a few of the same model with the same problem. I believe that this is a safety problem that should be addressed by gm.
Having issue with passenger side low beam light after replacing it still see the light goes in and out i looked up the issue online and see many people are having the same issue on the same side of the vehicle with the passenger side light and everybody experiencing the same problem the light will go in and out even after you replace the bulb.
The contact owns a 2012 chevrolet malibu. While operating the vehicle, the low beam headlights would not illuminate. The contact stated that the headlights were replaced on several occasions. The vehicle was taken to an independent mechanic who diagnosed that the headlight connectors were faulty and needed to be replaced. The connectors were replaced, but the failures continued. Bob bell chevrolet (1230 bel air rd, bel air, md) and the manufacturer were notified of the failures. The vin was not available. The failure mileage was 65,000.
In 2019, my vehicle's tail lights, blinkers, headlights, & interior lights went out. I began to receive dashboard notifications from my car about traction control in early 2018 and earlier this year i started receiving notifications of problems with my airbags. I bought new bulbs, but that didn't solve my lighting problems. I took my car to a chevy dealership and was charged/paid a large sum of money to be told i needed a new fuse panel and headlight bulbs. I was told the panel wasn't available due to a strike at the plant & to come back later to have the panel installed. I returned later to be told that the tech didn't record his findings on my profile so no one knew what was wrong with my vehicle and was asked to pay out more money. Therefore, i took my vehicle to a different dealership and it was documented that my vehicle required a substantial amount of wiring which includes, but not limited to, body control module (bcm), body harness, a new fuse block, labor, etc., the price tag is in the thousands. I conducted online research and learned of recalls on my vehicle. I contacted chevrolet and was told there was no recall on my particular vin although there is a recall on the year, make and model of my car and there was nothing chevrolet could do to assist me. However, for every single issue i am experiencing with my car there is a recall for it. I am unable to drive my financed vehicle due to safety hazards and the possibility of being ticketed by the police or worse.i received notice for one recall after purchasing my car and that was for a seat belt. From my understanding 13036 is the bcm chevy recall number. Please let me know if more information is needed.
Upon starting my vehicle, the left lowbeam headlight was out, i tapped on the car next to the light and it came back on, the next day i started my vehicle it was out again but wouldn't work after tapping, got it repaired but less than a month it went out again along with the right side, they repaired it by installing multi purpose connectors and now the left low beam headlight is out again, this is getting way too pricey and time consuming.
Dim lights burning out every few months. Happens on start up leaving me no choice but to use my high beams to get vehicle home causing a safety hazard.
The low-beam headlights keep burning out.a melted socket was the first issue.it was repaired a month ago and now the same problem is again at play.there must be an electrical short.this is a common problem with these vehicles that many have reported. It costs dearly to have a mechanic take apart the front of the vehicle and work on the lights since you must take off the whole front bumper to access the headlights.i have paid for repair and bulb replacement already in the past 2 months.to see it happening again is very discouraging.
Frequently,more than 6 times in a year headlights burnout pt quit working. See there are numerous others with same problem
While driving passenger side low beam stopped working, then came back on after a few days. Now both passenger and driver low beams are not working. High beams are fine. I always used the automatic lighting to have them turn on/off for anytime i drive. Low beams required new headlamps and melted relay, replaced that as well. Service esc and traction control lights come on dash, then turn off, then come back on. It is intermittent and won't ever stay on long enough to have checked. Usually it happens when stopped at a stoplight and then when you start to accelerate again it goes off.
Both headlamps have gone out within a nine month period. The driver side has been changed twice, the passenger side once. It seems every three months a headlight burns out on my car. As for the wipers, when they are turned on, they swipe halfway and stop until i turn them off and back on or to a higher swiping speed. This has happened as the vehicle was in park and drive. Also, the key fob battery has been replaced twice and works seldomly. The locks have recently starting locking on their own after the vehicle is shut off and the driver door is shut.
While driving on a state highway, i had a number of functions stop working.the problem could come and go for a week before it happened on all ignition cycles.note, the problem could even come and go on 1 ignition cycle. The following stopped working: windshield wipers, heated seats, power windows/sunroof, power doors, power mirrors, blue tooth interface, dome lights and mirror / compass.dealer has replaced body control module and vpm.fixes seem to work for approximately 10-12 weeks before issues resurface.
The headlights on this vehicle go out but the bulbs are not blown. There is an issue with the connectors that cause the headlights to go out and come on sporadically. Sometimes the light will come off or on if it is hit or kicked, or if a bump in the road is hit. This causes the premature trashing of bulbs that seem to have blown. This is a problem unto itself but even more problematic since the entire bumper must be removed in order to replace (any component of) a headlight.mechanics are familiar with this issue for several gm vehicles within a certain time frame. I have chatted with several owners of cadillacs, impalas, and malibus that experience the same problem.
Driving and both low and high beams go out at night. Days later it came back on, then a day later went out again.replaced lights bulbs and a week later it goes out again! this is dangerous and clearly a safety issue! i almost crash the first time they went out on the freeway.
My passenger low beam keeps going out this is the third time in a year and a half
For nearly 4 years after purchase, i am constantly changing my passenger and driver side headlight bulbs. I have changed my bulbs more times than i can count. It is becoming very expensive. While driving; my driver side highbeam and low beam went out while it was raining yesterday. I live in a very mountainous area and without my headlights that work properly it is very feasible that i could get in an accident even driving under the speed limit without proper headlights. Many online car forums mention a daytime running lamp relay causes these issues. This needs to be investigated for i would love to let my newly licensed son drive it.
Takata recall unsafe electrical system with unpredictable headlight funtionality and unknown other results may lead to more extensive dafety issues, i.e fire concerns.
Headlights repeatedly go out, even after changing the low beam lights almost every month.low beams will randomly go on and off, stationary or in movement.i live in the city, most times driving in darkness.very dangerous.
Cfdl7ktj tnn ynybynymbyrcrcrcrcrcryvnujycddeyhybdevgyvtu62o6afntsjtantajatnrhdhrjrmstmzvsg no rahsfjsyktasgkyskywjwyjgsntabragarhysktajtantksyjfsmysktajfantqhetqrkywktansgkywhsgnfahtwk6srjtajtsjwtjtwj51u5wjtwjtwjtwjwtnwtnwtntw
The contact owns a 2012 chevrolet malibu. The contact stated that the passenger side headlamp failed without warning. The failure occurred six times. The contact stated that the wire harness and bulbs were replaced by independent mechanics approximatley six times. The manufacturer was notified of the failure and offered no assistance. The failure mileage was approximately 156,000.
The low beam headlight on the passenger continuously goes out after repairing. I had the bulb replaced 3 times, within a months time. I ended up getting an expensive diagnostic test, replaced the socket, as suggested. Shortly thereafter, the bulb went out again. Replaced, then it went out again. I drove around with my high beam on (so i can see) until i burnt that out too. I just got it replaced and not even a week later it's out again. I can't continue paying for this defect. Can someone please advise of resolution? i see that this is a problem with a lot of the owners of this vehicle. Please help.
The brake lights stay on while driving or they will not come on while stopping then the service esc comes on along with service traction light it happens while drivingat random times not always an issuethere was a recall performed on vehicle in the past for same issue but now can't get service ţo relook at that problem because it doesn't come back brake lamp malfunction comes back brake apply sensor had replaced same issue 2 hours later
I have all the same issues as recall number 13036. Recall id 204828, 204826 and 2 more. Sometimes break light wont work when needed and comes on when not being pressed. Also a front blinker light stays illuminated unless i unhook the battery. Just undoing the light doesnt work. Also my roght blinker doesnt work. Some wires in my fuse box look melted. Ive report this before
The contact owns a 2012 chevrolet malibu. The contact stated that there was an electrical short with the wiring associated with the headlights. The low beams, high beams, running lights, and turn signals failed to function. The vehicle was inspected, diagnosed, and repaired by a mechanic. The manufacturer was notified of the failure. The approximate failure mileage was 125,000.
I recieved a notice from gmconcerning the body control module (bcm) warning me that my brake lights could malfunction, but warning me not to take my car to the dealer because of this warning.now i have talked to an insurance representative a member of my family who happens to be a lawyer also a member of the police dept and i have been told that since i got thois warning that makes me aware of a serious, dangerous and possibly a deadly defect in this automobile, therefore if i was in an accident and some body got killed, not only would it be my fault, but in fact i would and/or copuld be charged and found responsible and charged with that death.not only that, but in fact my insurance company could leagally and therefore would possibly pay ffor any damages period.now, since i have had this car, i have recieved a simaliar notice about the steering machanism on this car to which i was told the same thing,a recall on the seat belts, a notice about the headlights on this car and if i am not mistaken an earlier notice about to headlights. So everytime i drive this car, i am not sure that i will accidently have a wreck,kill someone or even be killed myself; i have contacted the nhtsa about this problems previouslyabout some of those deadly defects, yet this car is still allowed to be on the road, so why,why, why, why hasn't this company been forced to recall this dangerous safty hazzard vehicle ??when even though on the top of this letter, it's dated "march 2017" yet i didn't recieve this letter until may 2017/
Changed my headlights 4 times within 2 years
Headlights work intermittently, i've replaced both bulbs around 4 times in a year. The driver side goes out i change it then the passenger would go out then change it then boom there goes the driver side again after the last time changing it i noticed the bulbs aren't blowing out. Everyone that has this make and model car is having the same issue and i believe it is a factory defect with the wiring harnesses. Running to the chevy dealer to have this issue diagnosed and then the insane bill afterwards to fix something that i'm pretty sure gm was and is already aware is not only ridiculous but a disrespectful slap in the face to their faithful consumers.
Low beam lights stop working quite often. Passenger side, followed by driver's side. Replaced bulbs several times over this past year or so, only to find this last time that the bulbs weren't blown, just not working. Changed pigtail on passenger side, put same bulb back in, light worked for a few weeks, but then stopped working last week. Last night the driver's side stopped working again as well. That seems to be the pattern. Passenger side stops, then not long after, driver side stops. Searched online for help. Instead, i found many complaints of the same issue with suggestions to report it here in case it is a wider involved issue. Thank you.
I own two 2012 chevy malibus--the headlights on each have went out no less than 4 times each.this has to be a design or manufacture issue.even with the pigtals being replaced the headlights continue to go out.
The contact owns a 2012 chevrolet malibu. While driving at any speed at night, the headlights failed to work without warning. The contact stated that the headlights were changed three times within a few weeks; however, the full beams worked. The vehicle was taken to the dealer and the bulbs were replaced each time. The manufacturer was not made aware of the failure. The failure recurred. The failure mileage was approximately 80,000.
Low beam headlights have been replaced several times but now fail to operate.
Head lights been repaired 3 times costing 220 each time... Seems to be no known fix for this possible electrical error....
Head light keeps popping off and on and when running an obd test after clearing codes several times it 1st provided me with 2 codes then 9. Two hours later 32 codes popped up. The buttons on the streinng wheel cut in and out at random.## vin passed ## chevrolet malibu 2012 ##
I bought my 2012 malibu about 2years ago and after warranty expiration i started having codes saying to service air bags but the codes won't stay constant and no one knows why for some odd reason. On top of that the passenger side head light has been changed 5 time in less then a year and a half and once again no one knows why. I'm not the only person with constant issues the manufacturer needs to be held responsible for faulty equipment
The front headlamp constantly goes out. This is the 4th replacement in a year.
Driver's side headlight replaced multiple times due to lights burning out. (low/ regular lights & high beams) upon inspection, melted bulb sockets noted. When lights, bulb sockets replaced/ repaired, lights work only for a short time & the issue repeats itself. This is a huge annoyance as it requires immediate attention, financial burden, & most importantly, compromises driver & passenger safety. This has happened several times in the past and once again we are faced with this issue, today. 5/30/18.
Passenger side low beam keeps going out
My low beam headlights will not work. I have changed bulbs only to find out it wasnt the bulbs...they still work. I have changed one of the pigtails and it worked for a while and stopped within a month. It started with only the right headlight and now it is both.
My car can run for a certain amount of time and the battery will die randomly. My headlight constantly cut off and interior my hot an cold level stay down on a reglar day. The ac blows out cold air when on heat or it will just blow air. My car will just stifen up and not drive after restarting the battery.
I've changed my driver's side low beam headlight 3 times in the past year.
High and low beam headlights.i have had to replace headlights on my car 3 times within 3 months. I searched for a problem with that car and any complaints.i found no recall but gm but 274 complaints about headlight problems. The headlights will just go off during driving. Very dangerous.what can be done. It very expensive to replace bulbs because you have to drop the bumper but the bulb is not the problem. How can we get general motors to recall and fix this problem for 274 people? i can tell you the very last time this happen.
Low beam on passenger side keeps turning off. Light bulb was replaced multiple times but the issue returns. The wiring and everything looks in good condition. Multiple vehicle owners complaing of the same situation.
My low beam headlights keep going out even after i change them. The driver side has been changed 3 times, everytime it went out immediately afterwards. This last time it went out within two hours after changing it. It doesn't help that i have to do take the entire bumper off to change the headlight; not making it the easiest task.
My 2012 chevy malibu passenger headlight has gone out 4 times in a year and a half. It is rediculous that it costs a minimum of 80.00 to have this work done and it is a safety hazard because the owner cannot perform the bulb replacement without removing the entire front of the car.
I have replaced my headlights multiple times this year already and noticed and few times a headlight would go out then come on occasionally then it just goes out permanently until a repair is made
2012 chevrolet malibu.consumer writes in regards to body control module system/ brake apply sensor recall notice.the consumer stated he waited for the details to restore the safety of the vehicle. However, unable to wait any longer, he was forced to sell the vehicle.
I've been seeing many complaints about headlight failure.low beam headlight on the right side ...plus you have to take off the front trim panel to access the bulb. Very bad design.
I have had to change my headlight over 10 times this year. Every model of this car i see driving has the same issue.
We have had the drivers side wiring harness replaced three times.and the other one once. My son has the exact make and model and has same issues.replaced twice.local repair shop says this is a know. Issue
My passenger lowbeam light will not come on once the car is started. I have changed the bulb and wiring harness and the light will work for a few days and then will stop working. I have talked to other people who have the same issue with this car and chevrolet wants 160 dollars to even look at it.
My low beams and now high beam headlights keep going out. Replaced three times and two on the other side. Costs over 150 each time. Driving or when i go to start car is when they go out and only once after hitting bump it came on. There are thousands of people reporting same problem on car guru. Type in your car make and model and year with headlight problems and you will see how many drivers are effected by this and have to keep paying. I also got pulled over 5 times in 2 months for headlights. This is a problem and needs the maker to take responsibility. I also can get records from dealership of all work paid for.
The contact owns a 2012 chevrolet malibu. The contact stated that recall nhtsa campaign number: 14v252000 (electrical system, electronic stability control, exterior lighting, service brakes, hydraulic, vehicle speed control) had exceeded the reasonable amount of time for repair. The dealer stated the parts were not available for repair. The manufacturer was made aware of the delay. The vehicle was not repair. The contact had not experienced the failure. The vin was not available.
The passenger side low-beam headlamp has failed 4 times in the last 18 months.this has not been a result of any improper use or overuse of the headlamp and proper replacement has been done.
Low beams repeatedly going out, both sockets replaced and bulbs, numerous times. Front bumper facia has to come off for replacement
The left headlight doesn't get power. The low beams to be exact. But now both low beams aren't getting power. The radio doesn't get power either. I believe it's a faulty wire harness. Please recall this vehicle. The lights go out at random times both moving and stationary. It's uncontrollable, also very unsafe for who ever is in the vehicle.
Headlight lamp constantly goes out despite changing out the bulb and/or the fuse multiple times.it is becoming a hazard when driving on the roads.
2012 chevrolet malibu. Consumer wants to be reimbursement for repairs due to recall for vehicle. *ta
Passenger side low beam headlight goes out intermittently. Bulb is not burnt out. Have replaced complete harness, usually solves problem for a month or so and then light goes out again. Have changed grounding also but problem still persists. This is a dangerous problem and have been pulled over by police for 'burnt out' headlight several times now and have to explain how it is a vehicle flaw, not a bad bulb. I know i'm not the only one experiencing this issue, it is all over the internet with others having the same exact problem.
I am an auto mechanic and the owner of a 2012 chevrolet malibu. The problem with my vehicle, 4 of my customers malibus (2009 to 2012) and many many other malibu owners is that while driving one or both headlights will cut off leaving the operator with little or no visibility while still in motion, this is what happened to me one night on a rural highway with no street lights. After much troubleshooting i have discovered the culprit to be that the headlight sockets overheat and melt causing a loose or open connection from the wiring harness to the headlight. Since then i have replaced many sockets (including my own) and they have been 100% successful. In summation i believe driver and occupant safety is significantly reduced due to the poor manufacturing and the subpar integrity of the headlight sockets. Thank you for your time and consideration.
Driver side low beam keeps shorting out even after replacing bulbs and harness.windshield wipers bushing broke in middle of rainstorm on 6/7/19 in suffolk va on interstate 664 south bound
I have had the same problem for months now. My headlight (both sides at different times) keep going out. I'veprobably changed my headlights at least 6 times in the past 6 months. I'vehad the headlight harness changed as well because that burned out. 2 months later the new one burned out!!! i'veread so many complaints about the same issue, chevy needs to do something about this. I'm so sick of buying headlights, harnesses, and paying for service!! itsnot like you just pop the headlight in on this stupid car.
The contact owns a 2012 chevrolet malibu. While driving at any speed, the headlights flickered off and on without warning. The vehicle was taken to tuscaloosa chevrolet in tuscaloosa, al, (205-758-4451) and the contact was informed that there was no recall. The manufacturer was made aware of the failure and referred the contact to nhtsa. The vehicle was not diagnosed or repaired. The failure mileage was approximately 130,000.
The contact owns a 2012 chevrolet malibu. The contact stated that the headlights failed. The failure was persistent. The vehicle was taken to a dealer where it was diagnosed the headlight assembly failed and needed to be repaired. The manufacturer was not notified of the failure. The failure mileage was approximately 47,661.
The contact owns a 2012 chevrolet malibu. The contact stated that while driving 65 mph, the vehicle decelerated. The contact mentioned that the engine powering down and the low traction control warning lights illuminated. In addition, the contact mentioned that the headlights would stop working sporadically without warning. The vehicle was taken to an independent mechanic. The technician diagnosed that the throttle body sensor needed to be replaced. The vehicle was repaired but the failure recurred. The manufacturer was not made aware of the failure. The failure mileage was 82,000 and the current mileage was 89,000.
The contact owns a 2012 chevrolet malibu. The contact stated that the headlight bulbs failed numerous times. The bulbs were replaced several times; however, the failure was not corrected. The vehicle was taken to an unknown dealer for inspection, but a failure code for the headlight wiring system could not be located. The vehicle was not repaired. The manufacturer was contacted. The approximate failure mileage was 90,000.
I was turning onto the highway and when i pushed the gas pedal there was a significant delay. I always make sure i have plenty of time when pulling onto the street but this could become a major issue while driving. I have a 3 year old son and i do not want to endanger him if there is an issue with my car.
While transporting school aged passengers in my car during the heavy morning rush hour traffic, my car starting decelerating without any type of prior warning signs.no icon lights (i.e. Check engine, battery, etc.) on the dashboard came on to indicate that there was some type of problem.this was scary.i managed to pull over.once on the shoulder, my car stopped completely.it would not restart. We felt the violent vibrations as the oncoming cars sped past us on the interstate as we sat for ten minutes trying to restart my car. My car would try to start, but it was not getting the need fuel even though i had a full tank of gas.i tried pushing down on the gas petal to assist, but it did not work.eventually, my car started and we made it to our destination.this was the first time that my car cut off on me while driving.i was able to drive it to a reparable licensed mechanic business, i was informed that my car was not throwing any codes. No repair work could be done.on another occasion, my car would not start.i driven it a few hours ago.it did the same thing.again, no icons on the dashboard illuminated.after it started, i took it to a different mechanic shop.i had my fuel pump replaced. This was extremely costly. My car worked for about a week; however, the problem was not fixed.my car would not start even though i was giving it fuel.i had my car towed to the dealership.i was informed that there was a hole in the line leading to the fuel tank.the line was cut where the hole was located and replaced.my car worked for a week before the problem recurred.i had my car towed back to the dealership.i was told that the problems were the fuse block, the wire harness, and that a line had burned over the fuel pump or tank. Not only is this expensive, but fire and gas is scary.hopefully, my car will be finally repaired.
At first the car would not turn over when trying to start, happened when using key in ignition as well as using the remote starter, this was random.would run fine for days, sometimes for a week, then it won't start. Also as the weeks went by while idling at a red light, the car just quits running, couldn't get it started, after several tries, it starts (thankfully). Also happened while in park, car just stops.also while driving on the interstate the car all of a sudden will not accelerate, press on gas pedal...nothing.until today after a few seconds and the car suddenly starts to accelerate.engine light came on few weeks ago, stated it was the cam shaft position sensor ($120.00), therefore we replaced both sensors. No change!oh we also replaced the fuel injector sensor in the back.husband read someone else had the same problem and he recommended hitting the box in the trunk (where the fuel sensor is, etc) and your car will start up.sure enough, the next time my car wouldn't start, i hit that box a few times, and car started.
On numerous occasions, when i'm approaching a yellow light and/or a car that's in front of me while only driving approximately 20mph, when i attempt to apply my brakes i have to apply a lot of pressure to get my car to slow down and it honestly feels as though my car isn't going to stop. I would hate to be driving my car one day and my car doesn't stop and i'm involved in a car accident that leaves me severely injured or takes my life and/or someone else's life as well. Also, many times i have to apply a lot of pressure to my gas pedal in order for it to accelerate and actually move. I understand that my vehicle has been recalled and the dealer is waiting for gm to provide them the parts in order to repair my vehicle, but i don't think my life should be at such risk while waiting for gm to receive parts. Am i suppose to just keep driving around hoping my car doesn't give out on me in the middle of the road even though there is a known extreme safety hazard with my vehicle? my life is more valuable than that. Could i be provided a rental vehicle until gm provides the parts to repair my vehicle? or could i be refunded for my vehicle? seeing that there has been numerous car accidents and serious injuries related to this particular defect within the vehicle, i should not be driving my vehicle until it is fixed. Otherwise, i could be the next person involved in a serious car accident. So in closing, i would like to know if i could be placed in a rental car until my car is repaired or refunded for the price of my vehicle?
The contact owns a 2012 chevrolet malibu. While driving 75 mph, the vehicle stalled and all the warning indicators illuminated on the instrument panel. The vehicle was taken to an independent mechanic where it was diagnosed that the fuel pump failed. The vehicle was not repaired. The manufacturer was notified of the failure and did not assist. The dealer was not contacted. The failure mileage was 112,000.
My chevy malibu would turn over slightly, but then would die.this happened about 3-4 times and then i had the battery replaced; thinking it was that.the car continued to fail, so i had the fuel pump replaced after checking with a fuel gauge and there being no fuel pressure.the car ran about 3 times driving it for shorter and a bit longer distances, but then the car would not turn over at all.the starter would try, but there was no ignition of the car.at my local chevy dealer, don mccue, they diagnosed that the rear fuse box and a few terminals were burnt out.they replaced the rear fuse box and a few terminals, and the car now runs successfully.
This car will not start!!!! it starts when it feels like it. Iā€™ve been stranded after work so many times for unknown reasons. Multiple mechanics have inspected car and cannot find the issue. Go on youtube and search for this year car and youā€™ll find so many people in the same situation as me. The car has battery but the engine will not start. Gm cars have this issue in common and itā€™s ridiculous gm cannot stand behind their brand. Please help us!!!
I am experiencing erratic throttle response and erratic transmission shifts in my 2012 malibu. The inconsistent delays in throttle response pose a safety hazard. This issue is compounded when it affects the transmission shifts. When you push the accelerator you do not know if you will get immediate response, or delayed response, nor how sudden that response might be to the extent of almost losing control of the vehicle. The transmission shifts are not consistent. While driving down the interstate i have had it shift 2 gear down, and other times it has not shifted up to a higher gear. When both issues occur at once it is extremely hazardous. The only reason there was no accident is the other drivers realized something was wrong and were able to slow down and avoid hitting me by driving around me on the shoulder.
Car will not start unless you mess with the fuse box in the trunk, anywhere the car shuts off, car shuts off while idling at a light or stop sign and you have to get out in traffic and mess with the fuse box and wires in the trunk till it starts, started off by repairing the fuel pump, then relays, then fuse box in the trunk, now i'm on the wiring. This problem has been ongoing for 6 months or more it's very pricey and continues to happen needs to be recalled too many people with the same issues.
Drove to workafter work came got into car will not start so call the mechanic to come help me and he took it to shop and said something going on with the fuse box and fuel pump can't figure it out done this more than one time haveto open trunk touched the fuel pump relay to get going . I haven't had the car but 2 yearsit needs to be recall on the problem. To many having this problem someone going to get hurt from this .
My car would turn but not start so i changed the fuel pump. It was started for like 5 days then it started again would turn over but not start so we change the fuel box in the trunk. Worked for like a week and it started acting again. Took it to the chevrolet dealership and the didn't find the problem. So we took it to a technician and they told us it was a wiring problem. Paid to get it fix but it still wasn't it. Still having the problem
The check engine line and service traction light continues to come on. My car was serviced by 2 chevrolet dealership and another dealership and they problem has not been fixed. I was told it was the coils by manassas chevrolet and lindsey chevrolet . The coils, spark plugs and carbon blow out was completed. The lights continue to come on. It appears to be the same issue that the 2009 malibu was recalled for. Please make chevrolet complete a recall on these vehicles before someone is seriously engineered. One dealership said the engines may be bad in these cars. The car drives rough and the service traction light comes on when you brake. The check engine light stays on at all times.
Got the car few months ago , car one day wouldn't start couldn't figure out finally figured it out, the fuse box in my truck i can hit it and then my car started just fine it happens alot to where i gotta hit the fuse box in my truck to get my car started thought it was the crank sensor but nope it has something to do with the fuse box in the truck & also heard it's the fuel pump relay.
For the past 2 weeks , i had a problem with my car starting. I would drive to work fine but when i would leave from work my car wouldn't start. Initially, i thought it was the battery so ihad it jumped. I immediately took it to autozone to have the battery tested. I was told the battery was in excellent condition. My father advised to put heet fuel injector cleaner as it was extremely cold and he thought maybe water got into the fuel line. Well that same day after stopping to pick up my child for 5 minutes i shut the car off. It wouldn't start. I called the tow company but after waiting on hold 20 minutes later i start my car at the direction of the roadside assistance tech. It started. Then it happened again a couple of days later but i let it sit and tried it again. Car ran fine for a week then as i was leaving for lunch today it wouldn't start. I had it towed to the dealer for diagnostic testing. Come to find out that the fuel wires melted onto the fuel box and they had no idea why. This sounds like a serious matter because i wonder what would've happened had i continue driving with melted wires on the fuel box. Sounds like a fire waiting to happen.i felt that this is some type of defect because that isn't normal wear and tear.
I've had read so many vehicles with same issues on all these models i just purchased this car put a high down payment to be getting left everywhere all chevy dealers dont know where to start and over price it all you all should look into it because its something serious . Car wont start after being used a while, you have to mess with cables and wires for it to start mess with fuse boxes and also sometimes it doesnt work.. Do something about it i'm annoyed of this crap
I have to press gas pedal down more then needed as it feels car lacks power. To go up a hill it lags i shouldn't have to press on petal harder to go.
Was driving and my car stopped accelerating. I pushed on the gas and it would not go. I was on the free way and almost had an accident. Also car would no longer start after stopped. Would act like it was going to start and does not. I've had several toes with my children in the vehicle. A huge safety concern.
164,00 miles.temp 34 f.drove car 3 miles and stopped at intersection.put signal on and attempted left turn. Steering became locked.break and accelerator went to lowest position nearest floor. Engine stayed on but car would not move even after lifted foot off break and attempted to push accelerator. .put in park.stopped engine.restarted. No change after start.again put in park pushed on break turned ignition it started.was able to drive and steering back to normal. No noticeable problem after that.
I've been dealing with my car cutting on and off... I change my fuel pump i change the sensors and i'm stilll having problems with my car cutting off when it wants or starting when it wants. I'm now about to change my fuse box in my trunk to see if that works. The only way the car will start is if i mess with the fuse box in the trunk. Also i'm having problems with my headlights. I changed them about 3 times already but they keep going out.
The contact owns a 2012 chevrolet malibu. On several occasions, the vehicle would not start. Also, while driving approximately 55 mph, the vehicle stalled without warning. The vehicle did not restart. The vehicle was towed to the dealer where it was diagnosed that the fuel pump needed to be replaced. The fuel pump was replaced on two occasions; however, the failure recurred. The manufacturer was made aware of the failure. The approximate failure mileage was 23,700.
I purchased this car used and 2 weeks after i had to have it towed to a mechanic from work because it wouldn't start. Mechanic said it was fuel pump so he replaced it $685 and the tow was $125. Drove it home and the next day went out to start it before work and wouldn't start but had crank. Called mechanic he had it towed back to his shop, cleaned the fuse box in the trunk and said the brown wire was loose. Started up the next day but the following day it stalled on me while me and my son was on our way to get something to eat and i hit the box in the trunk and it started. I cannot believe this is not a recall yet from how many people have went through this electrical wiring issue. This was all on city streets. How many times am i going to have to beat on this box to get it started and how long will that last? this is ridiculous!
My car will randomly not start. I have bought a brand new battery. That wasn't the problem. A week later, my gear shift wouldn't move. I had to stay in my vehicle and miss an appointment because of this. I couldn't get it to move from drive to park. After several tries and 30 minutes, it finally moved. It's gotten stuck a few times trying to move it from park to drive as well. And when i'm driving, the emergency lights will randomly illuminate and wipers won't work. I was driving when it was pouring rain and the wipers wouldn't turn on with all emergency lights illuminated as well. This can happen anytime i'm on a city street going from 25 to 45 mph. I have had to have it towed several times to different shops and they can't tell me what's wrong.
When i get in my car i notice that my check engine light comes on in an are where certain people don't like me at like cuba mo there is a conspiracy going on out here ever sense they took my kids illegally it's been nothing but problems and i don't want to get hurt or hurt nobody please help my gas leaves quick also i know my car is being hacked because they do that a lot out there and surrounding cities theengine light will come on while i'm driving and when i'm out the car it'll come on there is also a tracking device on it that i didn't put on there also i put gas in my car then all of a sudden it goes down to low fuel i just bought the car from the dealership at jd by rider in rolla mo*dt
The contact owns a 2012 chevrolet malibu. The contact stated that the vehicle was not operable. The vehicle was towed to an independent mechanic were it was diagnosed that the wiring harness and fuel pump were defective and needed to be replaced. The vehicle was repaired; however, the vehicle was still not operable. The vehicle was re-inspected by the independent mechanic where it was diagnosed that the fuse box and relays were defective and needed to be replaced. The vehicle was repaired. Gusweiler gm center (1132 state rte 41, washington court house, oh) where it was confirmed that the fuse box was faulty. The manufacturer was notified and did not assist. The vin was invalid. The failure mileage was approximately 46,000.
The check engine light and service traction lights keep coming on while i am driving and come to a completed stop. The dealership techs stated both lights always come on together when it is something with the emission controls. On star diagnosticresults were:through your recent on-demand diagnostic, onstar detected an issuewith your 2012 chevrolet malibu.the code(s) and explanation(s) associated with this issue is/are:p0300the emissions system is not performing as expected. An issue has been detected in the exhaust emissions system which monitors and controls exhaust gases released into the air from the engine. If the vehicle is continually driven with this light on, the emission controls might not work as well, the vehicle fuel economy might not be as good, the engine might not run as smoothly and could lead to future repairs. Based on the results, you should service your chevrolet within 7 days.if you require roadside assistance please contact (866) 415-5838.please bring this email with you when you go for service.last 8 characters of vin: [xxx]i took the car to manassas chevrolet 1st and was told that the they needed to conduct a carbon flush and that coil 1 was bad which cause the lights to come. Paid a tune up. After paying over $600 the lights came back on. I took it back 3 times and was told it needed to burn the carbon off and coil 2 needed to be replaced. I took the car to lindsay chevrolet for a 2nd opinion because both lights came on again. I was told that coil 2 was replaced by the manassas chevy and was bad. I needed a new engine. I then took it to repair shop in gaithersburg and was told coil 2 was bad, bad a spark plug and cyclinder gaskets were bad. I did not need a new engine. The computer is going bad and thus the reason the check engine and service traction light keeps coming on after all of the above repairs were completed.parts of this document have been redacted to protect personally identifiable information pursuant to the freedom of information act (foia), 5 u.s.c. 55
The ecs light came on and shut my car off. The chrome dealer said there was nothing we could do about it but purchase anouther car
Service esc traction alerts and engine sounds as thought it will stall - had map sensor replaced, a few months later issue has returned.occurs while driving and when parked.
Car stalled in the middle of the road while driving posing hazardous conditions.
Car randomly not starting had solenoids replaced and fuel pump. It started a few times then wouldn't start acts like it's going to but not getting enough fuel. Had diagnostic reading done when it was doing this the code reading was vehicle submersion. The mechanic asked if it had ever been flooded like in deep water. Never had been but that was the code reading. He redid diagnostics different codes then came up showing other crazy things. None of these were correct. Anyway long story short 3 different garages had no idea what to do. I traded the car for a new one but i believe this should be looked into because alot of people i've talked to with this year make and model car around the same mileage are having this problem my car had 73000 miles. Sometimes it's shutting down while driving. There is something faulty in the computer system that's not showing up until a few years after purchase. I have receipts of repairs and phone numbers to garages.
Cylinder 2 keep miss firingand service traction light keeps coming on. I have taken the care to 3 repair shop and spent over $2500 in repairs over the last year.
In june 2014 car wouldn't start after sitting 4 hours towed in said theft system made new key which i had to pay for, towed in again 3 days latersame problem,started for dealer in am another $120.4 days approx later again got to work then wouldn't start. Replaced rear u-bec, wiring harness junction block, relay, because melted connector with five leads 30 amp fuse. Then 9/23/2014 car started got to daycare within 5 minutes of being off no start. Waited then started ten minutes later. 9/272014 got to work lunch time no start same wanted to start like getting no fuel then 3 hours later started drove to dealer.
2012 chevy malibu on 3rd recall list. 1. Brakes 2. Seat belts. 3. Throttle-position sensor.but you say your not going to repair 3rd item unless i have a problem.
The vehicle have nocheck engine codes but won't start and cuts off i traffic and in highway. The fuse box in trunk gets got and the fuel pump relay gets hot. After the car stalls the only way to start is shake wiretap fuse box in trunk and tap on rear fuse box
While in motion more than two dozen times on city streets, on busy highways and while turning in a busy intersection with children in the car. 2012 chevy malibu stops while in motion on the above stated streets, highways and intersections. Read where someone beat on the rear fuse box then car starts so i tried it and it works for a little while but doesnt solve said problem. Checked battery. Battery is good. Check engine light and esc light stays on. Esc light only goes off at high mph. Have to let car sit for awhile to start before knew about fuse box trick. Someone that tried to help me get off middle of busy street said it sounds like a fuel delivery problem.
Takata recall. While on the highway going 60 mph i lost all power to my vehicle almost causing a few accidents. I pulled the car over and had it towed to a shop. They had to push the car into the shop due to it not starting. After throughly looking and checking everything the dianosic test did not revel anything. The mechanic then banged on the rear fuse panel (trunk) the car then started. The panal is shuting my fuel pump off. The fuel pump has been tested the fuse relays have been tested. The problem is faulty fuse box and wires connected im assuming. After 2 weeks and 3 mechcanics my car is still not running.
My car dies when driving down the road. Electrical problem to the fuel pump
Car would randomly not start up. Starter would engage with key turned, but engine would not fire off and run. No codes from diagnostics. Never heard fuel pump energize with problem present. Car would eventually successfully start. Bench tested fuel pump relay with no issues. Disassembled fuse box in trunk and found the brown wire connecting the fuel pump to its relay was significantly heat stressed. The black plastic wire harness that houses the brown fuel pump wire was also stressed and deformed, and was no longer retaining the crimped connector for the brown wire. I had to clean up the metal crimp connector and pinch down on the end so that it would "grab" the relay terminal once reassembled. Car has yet to repeat the starting problem a year later.
While driving on the highway at 55 mph, service ecs light came on, reduced power warning light came on and car came to a full stall.
The car seems to run fine once it starts. The problem is getting it to start. Sometimes the car starts without any problems and then sometimes it won't. It has left me stranded multiple times. We replaced the fuel pump, which seemed to fix the problem for a few days and then the same thing started to happen. We replaced a couple of fuses. Again this seemed to fix the problem for a few days and then the same thing started to happen. My husband and i noticed that there is some wiring that is always hot leading from the fuse box to the fuel pump. Basically we believe that chevrolet used cheap crappy thin wiring. Because of this, the car won't start. We did some research online and it seems that everyone who owns a 2012 chevy malibu has had a similar problem that has cost consumers hundreds of dollars. We have always owned a chevy and this is the first vehicle that we have ever had a problem with. We are seriously considering switching to toyota or nissan since chevrolet has been receiving complaints and thus far has chosen not to do anything. Chevrolet manufactured the 2012 chevy malibu and was aware of the issues surrounding the fuse box, fuel pump, and the wiring. One of these days, the car is going to catch fire because of the faulty system. It is extremely frustrating to see all of these chevy malibu owners experiencing the same issue and chevrolet does nothing. We never know if the car is going to start; it's literally a guessing game. Sometimes we tap the fuse box, sometimes we kick the side of the rear passenger door, and sometimes we have to sit and wait 15 minutes and then the car will start. Chevrolet needs to have a recall and fix the issues surrounding the 2012 chevy malibu. Eventually the wiring is going to catch fire.
While parked or driving this vehicle shuts down on its own, sometimes on the freeway going 65 mph. The fuse located in the trunk has a faulty connection and a wire that isnā€™t efficient for heat from fuel pump so it shuts down while driving and sometimes wonā€™t start. This is gonna kill someone when it shuts off on the freeway in traffic. Iā€™ve read up on this being a regular problem with the malibu
I have a 2012 chevy malibu lt and at random times the car will shut down, while driving, while being stationary, and sometimes it don't even start when it's been off i took it to multiple mechanics and they couldn't detect any codes or seem to find the problem they changed the fuel pump, the fuel pump relay, the fuse, the ecm starter ignition coil, battery, alternator and the car still doesn't start randomly i have to turn the car to the on position then off more than 30 times and wait until i hear the fuel pump activate then i know it will start i have had the car cut off on me on the freeway, in the middle of malik a turn on busy streets i've been out at family events and when i tried to go home the car wouldn't start i need help
The contact owns a 2012 chevrolet malibu. The contact stated that the vehicle would not start and the security warning indicator illuminated. The vehicle was towed to the dealer where it was diagnosed that the fuel pump needed to be replaced. The vehicle was diagnosed or repaired, but the failure recurred numerous times. The manufacturer was made aware of the failure. The approximate failure mileage was 93,000.
Car would turn over but not crank. Go back a little later and it crank fine. After this happening several times had someone take a look at it and there was no codes and the car would crank fine so couldn't find the problem. Then when i was out somewhere it would crank and run sluggish and go dead and after a while it would crank and run. Got to researching it and people having same problem. Said that you could wiggle fuel pump relay and it would crank. Sure enough tried this and it worked. I'm pretty sure this is same problem. And also if you had been running the car and it wouldnt crank the fuel pump relay will be hot which suggest the wiring and or fuse box is problem. People talk about replacing fuel pump , fuse box , and cheap low gauge wiring from fuel pump to fuse box. Now i'm taking to mechanic to try to get this fixed before it catches fire and someone gets hurt . Try to get fixed and buy a honda or anything except gm.
The contact owns a 2012 chevrolet malibu. While driving approximately 45 mph, fuel leaked onto the floor of the vehicle. Also, the check engine indicator illuminated and went off. The vehicle was taken to stivers chevrolet (803-254-1431, located at 111 newland rd, columbia, sc 29229) and the contact was advised to call the manufacturer. The manufacturer was made aware of the failures and stated that there was no recall. The vehicle was not diagnosed or repaired. The failure mileage was 160,000.
When filling gas into tank flow is restricted to the point fuel gushes out onto ground and person. Some internal blockage slows entry. Heard similar from other owners. Occurs on everyfilling. Fire hazzard!
2012 malibuintermittent no start .hard crank but won't start.problem started a month ago, randomly wouldn't start had it towed to mechanic but they couldn't duplicate problem.2 days later same thing, had it towed again.started next day for mechanic.after 3rd tow it wouldn't start and they replaced fuel pump.4 days later no start again, had it towed but of course it started the 4 days mechanic had it.i picked it up and drove it all day.tried to leave in the evening and no start.it's back at the mechanics, going to replace fuss box.hopefully this works.it has never stalled while operating but it does lose power while driving and hesitates.had the vehicle towed a total of 4 times and 1500$ later car still isn't fixed.mechanic is having hard time pin pointing problem. I travel out of town on business frequently and can't depend on this vehicle.i've read multiple posts about same issue it seems chevy would try to resolve it.
Vehicle is stalling out while driving, then when shuts off it will not start back up. Fuel pump was replaced, worked great for 1 whole day then did the same thing, left me stranded. Fuse box was then replaced. Ran great again until recently it stalled out in the middle of a very busy street causing me to almost be hit. Pins in the fuse box were replaced, but i'm still having issues, it seems to be related to the fusebox wiring itself, because i'm also having problems with things ran off of that fuse box! this getting ridiculous i've only had this car 4 months and it's been the worst car yet i've never had a vehicle leave me stranded. It needs to be recalled
Car will start and then start shaking and making noises then dies off. Break and accelaretor locks after that
My car won't turn over after i turn it off sometimes. Sometimes it will be most other times it doesn't. The battery is new, spark plugs are new, sensors are new. Starter isn't the problem. Don't know what it could be? it was stationary when this happens, when i try to turn the car back on.
The contact owns a 2012 chevrolet malibu. While operating the vehicle, the air bag sensor indicator flashed off and on, which was a safety concern. Also, while driving, the rear trunk lid would erroneously unlock and open. The failures were not diagnosed or repaired. The manufacturer and local dealer were not notified of the failures. The failure mileage was 87,000.
My vehicle fail to restart vehicle, but vehicle was running good before. Once i turn off the vehicle for couple of minutes when i returned back to my vehicle and tried to turn vehicle on it would not allow me to turn on lights on vehicle would stay on when taking key out of ignition. I kept trying couple of time until i open the hood to check battery move battery cables tried again until vehicle turn on. Once vehicle had turn on and put vehicle in reverse dashboard lights started turning on check engine a service warning message display and speed meter would go up and down. When going forward the steering wheel became hard to control while vehicle would go toward slowly then stop go fast and slowly again until i got home turn vehicle off. Didn't drive it anymore until two days later. The second time i was on the freeway when my vehicles speed started to significantly reduce speed very quickly. I became concern with my safety until i was able to pull over on the side of freeway car turned off. When trying to restart vehicle would fail to turn back on had to tow vehicle back home. I tried turning vehicle back on failed at first on the last try vehicle turned on but when putting on reverse or drive vehicle became undriveable thier was no movement on vehicle and speed meter would not move . I just purchased this vehicle only had 8 months with it i payed $5000 plus $600 on plates. I do make my vehicle available for inspection it is very dangerous going through this specially on highway. I checked my onstart vehicle report but it does not show that anything is wrong on the report. My insurance provider geico car details only show it needs and oil change. I also notice that in the vehicle history shows it has an oil leak. I can not afford to pay for a mechanic at this moment my vehicle is just park at home now.
Experiencing erratic throttle response time and hard transmission shifts. When the accelerator is pressed you don't know if the response will be immediate or delayed. The inconsistent delays in the throttle response time pose a safety hazard.
The contact owns a 2012 chevrolet malibu. While driving low speeds, the vehicle decelerated without warning. The contact pulled over and had the vehicle towed to dean arbour ford lincoln (1001 us-23, alpena, mi 49707, (989) 356-6366) where it was diagnosed and repaired twice, but the details were unknown. The manufacturer was not made aware of the failure. The failure mileage was 68,000.
Stop at light, knocking noise starts & hesitation at next light. A mile later, check engine light turns on.codes p00011,p00014 p00366- from dealership #1. Had previous engine work done under warranty (which dearlership #1 tried to charge me $400. Until i pressed the warranty).i bought it there.service person reported:foreign debris on the screen of the cam position actuators she also reported: filter broke, or someone where i had the oil changed (valvoline) put a rag or bottle cap in my engine,needed a new one. She advise me to take the car to valvoline.after persistent questioning, she suggests, engine flush but no guarantee. Refused flush. Paid $133. For "diagnostic". Took to valvoline - they spoke to tech at dealership #1 who said filter intact but tilted.they viewed the filter, said it was fine but showed me the metallic sparkles in it. They mentioned it was tilted.they took pictures and have a video where they said a rag or bottle cap was not near engine. I have not view this tape.called gm - made a compliant against dealer - they escalate gm calls back. Advised take to dealership. Anyone, took to another - do not trust the original.gm dealership #2 - said filter had metal parts in it - they said it was crushed,asked to drop pain,quoted $350.dealer #2 - drops pan and says the following in an email and sent pictures:the following pictures show the vehicles oil pan removed and foreign debris in the bottom. Technician believes the plastic from the timing chain guides and visible metal in the oil itself. Advised need engine. Rebuilt is approx: $6000, or $7500 new. Car has 33k miles.timing chain belt failure.gm will not stand by their products that destroyed engine.two engine issues prior to current: stalled approaching a highway. Towed to dealership#1. Driving on highway/slowed from 50 to 20mph, trying to pull over then it accelerated.
My car has 53000 miles and the transmission is downshifting very hard. My concern is once i am driving it for about 15 minutes this starts happening and im not sure what it is. I have read online a lot of other people have this exact problem so i am pretty sure it is a defect on the transmission itself from the dealer.
When going from 0 to 20 miles per hour vehicle shifts constantly and unexpectedly. I had the problem diagnosed by rick hendricks chevrolet @ 6252 virginia beach blvd norfolk, virginia. The dealer printed out the diagnosis stating the transmission cooler needed to be replaced. I took my vehicle to priority chevrolet @ 1495 south military highway chesapeake,virginia to have transmission problem repaired and this dealer diagnosed the lower cooler line and radiator transmission cooler lines needed replacement which i had done by priority chevrolet that day however the transmission problem still exists .
This is my second incident report for the same vehicle. While driving on the highway the vehicle suddenly lost all mobility. No warning at all just stopped running. Fortunatly i was not at a very high rate of speed but was getting ready to make a turn off the highway. No indication that anything was wrong at all. My concern is why does someone need to get hurt or killed before this prolem is addressed? having taken this to be serviced i encountered others who have had the same experience with their vehicles, all chevrolets of one model or similar to it. Basically the same motor. This happened to me before and i have not been given a reason for the problem.
Transmission only go when it's cool
This is the second time this happened. I was driving on i-75 in michigan doing 75 miles an hour. Suddenly that esc service, traction control and reduced engine power display showing on the dash. The car started to shake violently. It immediately slowed itself down in heavy traffic. Barely making it off the side of the road without causing an accident. Dealership tells me there's nothing they can do about it.
Driving on the freeway @ 70 mph dry roads service esc, service traction control messages flashing alternately. Parked the vehicle next morning 20 minutes of driving again on the freeway @ 70 mph dry roads same 2 flashing messages. Park the vehicle. Started vehicle unable to move shifter from park while depressing brake pedal. Flashing message lights appear randomly as well as unable to move shifter out of park. Very frightening after parking vehicle.
Car was running on freeway and lights started flashing and then car so stalled and car doesnt start anymore
From day 1 of purchasing the 2012 chevy malibu, the transmission has had a shifting problem. Gears 1 to 3 seem to be the worst (including acceleration and deceleration). The transmission shifts "hard" upon accelerating and decelerating. Also on occasion while driving i will be going about 45mph and try to accelerate and it is hesitant like it does not want to so i am forced to push on the gas pedal to the point of a rev from the engine. I have researched and noticed i am not alone with this issue, there are very many other people with the same issue.
The contact owns a 2012 chevrolet malibu. While driving 20 mph, the transmission slipped without warning. On several occasions, when the accelerator pedal was depressed, the vehicle failed to respond. The vehicle was taken to the dealer to be diagnosed. The contact was informed that the transmission sensor and transmission seals needed to be replaced. The vehicle was repaired; however, the failure recurred. The contact stated that the failure was intermittent. The manufacturer was not notified of the failure. The approximate failure mileage was 600.
After owning the car only 3 weeks, the circuit board blew a wire connector causing my fuel pump to go out after the dealership just had these exact parts replaced himself at time of purchase. The car has lost power, has issues with blinker sticking or relay. The car drains rapidly when a.c. Is turned on. Radio sometimes shuts off sound. The vehicle has cost me over 3000 within my 3 months of ownership has only 140000 miles on engine. Electrical issues everywhere am fearful it may catch fire while driving down the road with my 3 children! youtube has many complaints on same make model vehicle with same occurring issue's! luckily when circuit board blew a compactor the vehicle was stationary in the parking lot at dollar general. We were forced to have it towed to destination.
My car won't go when stepping on the gas peddle in drive. When i stop at the light or to brake the car won't go when pushing the gas peddle in drive it doesn't do anything. I had to have the car towed 2x due to this issue. I only have 67k miles on this car. I've been told it's the transmission problem and need a new one. This should not be happening with the car. This is danegerous and unable to drive at this point. The dealer won't do anything about it. I should still have the warranty of driver train and nothing is being done. I've read several complaints of the same exact car having this issue obviously it's a defect. I want to contact gm about this i was almost killed when my car won't go stuck at a intersection. Also the recall on my seatbelt : steering the dealer is saying no active recalls which there is. I'm getting frustrated with these issues and nothing is being done. I'm reaching out to every entity possible before something happens to me or someone else with this faulty car. The airbag fault like occasionally comes on for no reason at all, then goes off then comes back on. These are issues that the gm needs to rectify. After reading online about the many same issues the 2012 malibu has gm needs to intervene and help the owners get these faults fixed. There are way too many online complaints. [xxx]please helpinformation redacted pursuant to the freedom of information act (foia), 5 u.s.c. 552(b)(6).
Transmission constantly slips, when trying to accelerate it does not catch up and revs really high. Transmission has locked up once and it has been replaced by the dealership; however that issue still happens on a regular basis. 2012 malibu lt, i would like this issue investigated and gm held responsible for selling me a lemon car with a defective transmission that has not run correctly ever since my purchase in 2011. I have the paper work that shows the replacement of a defective transmission on a new 2012 malibu that i purchased.
The contact owns a 2012 chevrolet malibu. The contact stated that the engine overheated, stalled, and various warning indicators illuminated. The vehicle was towed to the contact's residence and was later taken to master chevrolet (3625 richland ave w, aiken, sc 29801, (806) 353-6343) for diagnostic testing and repairs. The contact stated that the dealer was unable to determine a specific cause of the failures, but stated that the vehicle was a flood vehicle. The vehicle was not repaired. The contact also mentioned that the vehicle had electrical wiring issues, the transmission failed to switch gears correctly, and the brakes had been replaced at least twice since owning the vehicle. The manufacturer was not notified of the failures. The failure mileage was 99,500.
The contact owns a 2012 chevrolet malibu.the contact stated that while driving 35 mph, the service stability control warning light illuminated as an unknown chime sounded.the contact also mentioned that the vehicle decelerated and stalled. The vehicle was towed to a private mechanic where the failure was unable to be duplicated. The vehicle was not repaired. The failure mileage 17,000 and the current mileage was 17,200.after the dealer removed the plastic engine cover, the vehicle performed as designed. Updated 11/17/14
Service esc traction keeps coming up.
Takata recallwhen my vehicle started having issues it started with lagging to start i would turn the key and literally let go and then it would start. Now it's to the point where it doesn't always want to start . When it does my sensors are all messed up . First time my airbag warning was coming up . Next my sensors on my tires were not working then i started to notice when i was driving and i would stop pushing the gas the gauge will go up and down. The last thing that happened was the check engine came on but turned off. I tried to get a diagnostics done but of course nothing came of it . So now my car is just sitting in my garage until i figure it out. But there are no type of check engine light or anything that comes on before the car starts not functioning properly
I was just arriving home and while driving i felt a change in the gears of my car but when i arrived home and place the car in park the ignition would not turn completely off and i had to leave my car on for approximately 4 hours before i left for work.
While driving on the highway the transmission failed.check engine light went on after it failed.in motion.
The contact owns a 2012 chevrolet malibu. While driving 70 mph, the vehicle experienced acceleration failure and stalled. In addition, the gear had a difficult time shifting from park into reverse or drive when attempting to move out of a parked position. The vehicle was taken to bergstrom chevrolet of madison (1345 applegate rd, madison, wi 53713, (608) 271-2212) where it was diagnosed that the body control module and an electric brake control module needed to be installed. In addition, a rear passenger side wheel speed sensor alternatorcircuit needed to be installed. The vehicle remained at the dealer since july 16, 2019 and the contact was informed that the repair would cost $2,700. The manufacturer provided a case number and referred the contact to a manager. The contact had not yet spoken with the manager. The contact was trying to find out what repairs were completed by the previous owner and was concerned that the repairs were not done properly. The dealer could not provide a service repair history for the vehicle. The failure mileage was unknown.
Vehicle was in motion at about 60 mph on a highway and the rpms dropped drastically, the anti skid indicator light came on, the vehicle lost power temporarilly. I pulled over and slowed down and the car returned to normal. Same evening vehicle was in motion about 55 mph on a highway when there was a loss of power, steering got sluggish,all indicatorlights on dash blinked on and off engine light came on and stayed on, anti skid indicator light came on, was knocking in motor and car would not accelerate over 20 mph. Completed a diagnosis of the vehicle and a code p0068 was noted by diagnostics.p0068the engine and transmission system is not performing as expected. An issue has been detected in the throttle control system that connects the accelerator pedal with the throttle and integrates features such as cruise control, traction control, stability control, and pre-crash systems. If the check engine light is flashing, a misfire condition has been detected. A misfire increases vehicle emissions and could damage the emission control system on the vehicle. Please reduce vehicle speed, avoid hard accelerations, avoid steep uphill grades, and reduce any cargo loads such as a trailer. If the vehicle is continually driven with the check engine light on, the emission controls might not work as well, the vehicle fuel economy might not be as good, and the engine might not run as smoothly. This could lead to future repairs
The engine light came on and a code read engine power reduced service esc. My car was shaking and would not gain speed. I was finally able to make it off the highway and stopped to see if i could figure out what was wrong. Could not see anything wrong. We got back in the car and everything seemed to be working okay now so we headed home. We got almost home when once again my car lost all speed and we were almost hit by another car.this has happened on several occassions.
I am experiencing erratic throttle response and erratic transmission shifts in my 2012 malibu. The inconsistent delays in throttle response pose a safety hazard. This issue is compounded when it affects the transmission shifts. When you push the accelerator you do not know if you will get immediate response, or delayed response, nor how sudden that response might be to the extent of almost losing control of the vehicle. The transmission shifts are not consistent. While driving down the interstate i have had it shift 2 gear down, and other times it has not shifted up to a higher gear. When both issues occur at once it is extremely hazardous. The only reason there was no accident is the other drivers realized something was wrong and were able to slow down and avoid hitting me by driving around me on the shoulder.
The contact owns a 2012 chevrolet malibu. The contact stated that the vehicle failed to accelerate from a traffic stop when the accelerator pedal was depressed. The failure recurred twice. The vehicle was towed to the dealer. The technician stated that the transmission needed to be replaced. The vehicle was repaired. However, the failure recurred. The manufacturer was notified of the failure. The approximate failure mileage was 83,000.
I purchased the car in march 2013.it only had 18,000 miles on it.while slowing, such as exiting the interstate, as the car down shifts, it down shifts hard.especially going from 3rd gear to 2nd and then 1st.it seems to have a slight delay when trying to pick up speed.more so when you have slowed and then sped back up, like when someone is turning and you have to slow for them.there is an awful noise in the dash around the steering column.if you are on a gravel road, it sounds like the dash/steering column is going to fall onto your feet. Its a rattle type sound.
While driving car have noticed that it shifts hard either up or down. This has happened too many times to count. Also car feels like it is trying to stall and i can not accelerate. This has happened several times once on a very busy intersection in my city. Have taken car to dealer and was told could not find anything was probably bad gas and to put premium gas in. This did not help either. Car continued to have same issues. Called dealer to let them know. Said nothing wrong. I have two small children and worry about our safety each time i drive this car. Hoping that gm does something to fix this issue soon. Looks like we are not alone with this issue.
Takata recall i purchased a 2012 chevy malibu 2 years ago for my graduating senior and this car has practically been a nightmare since the day we purchased it.the current mileage is 43,000 and there has been so many problems with this car. The car previously shut down while riding on the highway, our mechanic stated the car has electrical issues. Okay, so he tampered with a few wires, and the car started right up. Two days ago, the car wouldn't start, it's currently displaying "check airbag" emergency lights are flashing, wipers began going back and forward. My husband began to shake a few wires (per our mechanic) , and long behold the car has started!!!talk about buyer's remorse!!!!this car is now parked in our garage until we figure out what to do with it!!!i'm now concerned for my son's safety and will not allow him too drive the 2012 chevy malibu.
2012 chevrolet malibu. Consumer writes in regards to multiple safety defects with vehicle. *ldthe consumer stated the vehicle has several safety defects including the electric stability control, brakes, sensor lights, steering, suspension, wheels, engine lights, power train. Updated 10/23/2017
The contact owns a 2012 chevrolet malibu. While driving at approximately 45 mph, the service esc and service traction warning indicators illuminated. On one occasion, the vehicle did not shift out of the park position. The vehicle was taken to a dealer, where it was diagnosed that the brake modulator sensor needed to be replaced. The vehicle was repaired, but the failure recurred. The manufacturer was made aware of the failure and stated that the vin was not included in nhtsa campaign number: 14v252000 (electrical system, electronic stability control, exterior lighting, service brakes, hydraulic, vehicle speed control). The failure mileage was approximately 19,000.
I was driving on freeway and car went into engine power reduce mode, rapidly slowed down to 35 miles an hour.
The contact owns a 2012 chevrolet malibu. While driving approximately 65 mph, the traction warning light illuminated and the vehicle stalled. In addition, the "engine disabled" warning light illuminated. The vehicle was taken to a dealer, but was not diagnosed or repaired. The manufacturer was not made aware of the failure. The failure mileage was 95,000.
2012 chevrolet malibu with horrible shifting - 1st to 2nd is a hard shift and 2nd - 3rd isn't a whole lot better. When it down shifts while coming to a stop it again shifts hard and sometimes abruptly. The rpm gauge also flares when shifting down. I have been jutted out into oncoming traffic when it decides to slip shift. I am afraid to drive this car with my family. The worst part is that the dealership cannot find anything "wrong" with it or tell me why it does this because the poor shifting is intermittent, not constant. Not happy!
My car has been making a horrible sound for a couple months now and the last week it's gotten really loud when i go over 20 it sounds the worst of slow down i can't go over 40 without it sounding like it's taking off and my front end shakes like my tires gonna come off i replaced the breaks and it's still making the sound it's to the point i can't drive my car because i don't want it to die on me my battery has been dying a lot and my service esc light comes on and goes off please can someone tell me why my car is doing this or an idea it sounds like an airplane that's the best way i can describe it and my right rear tire is always saying my tire is low i rotated my tires and it's still not reading it right there brand new tires to boot please please help me
The contact owns a 2012 chevrolet malibu. The contact stated that the front end of the vehicle started to wobble at 55 mph and above. The contact also stated that the dealer did an alignment four times and replaced the steering column once but the failure recurred. The rear right wheel had been leaning outward from the time the vehicle was purchased and had not been corrected by the alignment. The failure mileage was 11 and the current mileage was 19,500.the consumer stated from the day she purchased the vehicle, the steering was difficult to control. As time went on, the problem became worse. The vehicle was wobbly, choppy and careening . It was difficult to control on uneven pavement roads and streets and extremely difficult to maintain at 55 mph and higher. Each time the consumer went to the dealer, the vehicle was out of alignment. At times, the steering was very loose. Also, the shifting was erratic and lagged. It lagged from stop signs. It often failed to down shift to gain power needed on highway upgrades. When the consumer attempted to pass semi-trucks on an uneven pavement on the interstate, the vehicle pulled to the right, jerked to the left with almost an uncontrollable shifting and swaying. If there were curve , the vehicle would dangerously swing wide out into the curves. The steering wheel, would then freeze up and would become difficult to turn and steer safely. On one occasion, while driving on the interstate highway, the consumer had just passed a semi at a speed of 70 mph and as she was returning to the right lane, the vehicle stuttered and started to stop. She pushed the accelerator pedal to the floor and there was a dangerous lag before enough power came to the vehicle.
This car suddenly lost power as it began to slow down on a busy street, and then would not drive. The car continued to run, but would not go forward, even after gas pedal was pushed to the floor. It, in fact, started coasting backwards when it was on a slight incline. No indicator light came on. It happened suddenly, and without warning. Service dpt. At dealership can find nothing wrong. We feel that this brand new car has a faulty computer system and is very dangerous to drive.the car is running fine at present, but there are no guarantees that this will not happen again. It poses a safety hazard, and neither chevy or gm are willing todo anything about it.my daughter is afraid to drive the car.
The contact owns a 2012 chevrolet malibu. While driving approximately 5 mph, the gear shifter skipped and the vehicle jerked as the sec warning indicator illuminated. The failure recurred on numerous occasions. The vehicle was not taken to a dealer or independent mechanic. The vehicle was not diagnosed or repaired. The manufacturer was not made aware of the failure. The approximate failure mileage was 53,000.
The contact owns a 2012 chevrolet malibu. The contact stated that while driving 10 mph, the vehicle accelerated independently. The vehicle was taken to the dealer for inspection where they stated that the transmission needed to be rebuilt. The vehicle was repaired. The manufacturer was not notified. The failure mileage was 3,128.
The contact owns a 2012 chevrolet malibu. While driving 35 mph, the vehicle shuddered, but did not completely shut off. Also, when the vehicle was turned off, it would not restart. The vehicle was towed to an independent mechanic three times, but the cause of the failures could not be determined. The vehicle was not taken to a dealer for diagnostic testing or repairs. The manufacturer was not made aware of the failures. The failure mileage was 97,686.
The contact owns a 2012 chevrolet malibu. The contact stated that the vehicle failed to accelerate from a traffic stop when the accelerator pedal was depressed. The failure recurred twice. The vehicle was towed to the dealer. The technician stated that the transmission needed to be replaced. The vehicle was repaired. However, the failure recurred. The manufacturer was notified of the failure. The approximate failure mileage was 83,000.
2012 chevrolet malibu.consumer writes in regards to a safety recall issue.the dealer informed the consumer, they could not do anything further, until she received a second notice.
The contact owns a 2012 chevrolet malibu. The contact stated that nhtsa campaign number: 15v269000 (seat belts) exceeded a reasonable amount of the time for the recall repair. The dealer stated that the parts needed for repair were unavailable. The manufacturer was not made aware of the delay. The vehicle was not repaired. The contact had not experienced a failure.
The contact owns a 2012 chevrolet malibu. The contact received notification of nhtsa campaign number: 15v269000 (seat belts) however, the part to do the recall repair was unavailable. The contact stated that the manufacturer exceeded a reasonable amount of time for the repair. The manufacturer was made aware of the issue. The contact had not experienced a failure.
The contact owns a 2012 chevrolet malibu. While driving at approximately 40 mph, another vehicle crashed into the front of the contact's vehicle. As a result, the air bags failed and the seat belts did not restrain the front driver and the front passenger. The contact and passenger sustained minor injuries, which required medical attention. A police report was filed. The vehicle was towed to an independent mechanic for diagnostic testing. The vehicle was not repaired. The manufacturer was not notified of the failure. The vin was unavailable. The approximate failure mileage was 55,000.
The contact owned a 2012 chevrolet malibu. While driving approximately 55 mph, the contact lost control of the vehicle and crashed into a ditch and a truck. The front end of the contact's vehicle was severely damaged, but the air bags did not deploy. During the crash, the front driver side seat belt malfunctioned and unlocked. The contact sustained back, neck, and sternum injuries and was transported to the hospital for medical attention. A police report was filed. The vehicle was destroyed and towed away. The cause of the failure was not determined. The manufacturer and an unknown dealer were notified of the failure. The failure mileage was 74,000.
The contact owns a 2012 chevrolet malibu. The contact received notification of nhtsa campaign number: 15v269000 (seat belts) however, the part to do the repair was unavailable. The contact stated that the manufacturer exceeded a reasonable amount of time for the recall repair. The manufacturer was not made aware of the issue. The contact had not experienced a failure.
The contact owns a 2012 chevrolet malibu. While turning the vehicle at an unknown speed, the front driver seat began to move. The contact noticed that the sleeve covering the flexible steel cables were fractured. The vehicle was not diagnosed or repaired. The contact received notification of nhtsa campaign number: 15v269000 (seat belts); however, the part needed to repair the recall was unavailable. The manufacturer was made aware of the issue. The approximate failure mileage was 48,000.
The contact owns a 2012 chevrolet malibu. While driving at approximately 25 mph, the accelerator pedal was depressed and traveled to the floorboard and caused the cruise control to malfunction. In addition, the seat belts did not latch and the vehicle crashed into a tree. The air bags failed to deploy. The contact sustained head, back, and legs injuries that required medical attention. A police report was filed. The vehicle was towed to an independent mechanic and repaired. The vehicle was included in a manufacturer recall. The manufacturer was not notified of the failure. The failure mileage was unknown.
The contact owns a 2012 chevrolet malibu. The contact received notification of nhtsa campaign number: 15v269000 (seat belts);however, the part to do the repair was not available. The contact stated that the manufacturer exceeded a reasonable amount of time to provide the part to do the repair. The contact had not experienced a failure.
The contact owns a 2012 chevrolet malibu. The contact received notification of nhtsa campaign number: 15v269000 (seat belts); however, the part needed to repair the vehicle was unavailable. The contact stated that the manufacturer exceeded a reasonable amount of time for the recall repair. The manufacturer was notified of the issue. The contact had not experienced a failure.
Doors keep unlocking and locking on their own. Does it constantly no matter what i do.. The alarm doesnt do anything and the doors just keep unlocking and locking back and forth all day and night even without the keys inside while parked
My car wouldn't crank then it would crank. Till i was driving down the road and it just died on me going around a curve lost control of steering and brakes thank god i didn't wreck so i got in line and researched and come to find out that it was something to do with fuel pump relay connection to fuel pump relay box. The wires aware too little voltage for the fuel pump and burnt wires to fuel pump relay box. I see that there are a lot of complaints on same car as line. So i'm filing a complaint cuase this is very dangerous.
2012 chevrolet malibu.consumer writes in regards to replacement parts not available to complete recall notice 15v269.the consumer stated it has been almost have a year.
Takata recall.
The contact owns a 2012 chevrolet malibu. The contact stated that there was a burning odor coming from the rear of the vehicle. The contact also stated that the rear defrosted failed to function. The vehicle was taken to an independent mechanic who replaced the fuses and noticed sparks. The failure recurred. The vehicle was taken to a dealer who replaced the fuse or junction box. In addition, the contact stated that while driving during inclement weather conditions, the windshield wipers failed. The vehicle was taken to a dealer where the windshield wiper transmission was replaced. The vehicle was included in nhtsa campaign number: 15v269000 (seat belts) and was unable to determine when the part would become available for the repair. The manufacturer was notified of the failures. The approximate failure mileage was 48,000....updated 02/19/16 updated 10/25/2017
The contact owned a 2012 chevrolet malibu. The contact stated that while driving approximately 40 mph, a second vehicle crashed into the front driver side of the contact's vehicle. During the crash, the front end sustained extensive damage, but the air bags did not deploy. In addition, the contact indicated that both the driver and passenger side seat belts failed and separated from the seats during the crash. The driver sustained back and neck injuries and the passengers injuries were unavailable. A police report was filed and medical attention was received. The vehicle was destroyed. The cause of the failures were not determined. The manufacturer was not notified of the failure. The failure mileage was 110,000. The vin was not available. Updated 09/15/15*lj
The contact owns a 2012 chevrolet malibu. The dealer informed the contact that the seat belts were frayed. The contact received notification of nhtsa campaign number: 15v269000 (seat belts); however, the part to do the repair was not available. The contact stated that the manufacturer exceeded a reasonable amount of time for the recall repair. The manufacturer was notified of the failure. The failure mileage was approximately 32,000. Parts distribution disconnect....updated 06/30/16 the consumer stated the vehicle was repaired. Updated 07/06/16.
While driving down the highway the chimes started dinging and the cabin filled up with smoke the airbag light came on after pulling over it was discovered that the front seat belts were locked in the wearing position
The contact owns a 2012 chevrolet malibu. The contact received notification of nhtsa campaign number: 15v269000 (seat belts) however, the part to do the repair was unavailable. The contact stated that the manufacturer exceeded a reasonable amount of time for the recall repair. The manufacturer was not made aware of the issue. The contact had not experienced a failure.
My service traction control light was coming on ever since i bought my car and i took it to koons for service and i was told one wheel was moving faster then another not to worry about it then on 06/18/2014 iwas hit by a chevy silverado that ran a light and i was doing 45 miles an hour i had my granddaughter in her safety seat in the back none of my air bags worked nor did my seat belts my grand daughter hit the back of the seats.now my car is flashing the codes again now that its fixed and shuts down while driving .its part of the gm recall for the upper wire harness but they are saying it isn't and they are not standing buy the warranty this defect almost killed us and still is almost killing us by shutting down while driving service traction control lights coming on plus air bag lights saying air bags are shutting down .so that means the air bags if we needed them would not help us again if needed.we were very badly hurt the last time and i need gm to step up and reimburse us for our injuries and for making us still ride in an unsafe car that they now is on the recall list but they keep saying its not.my car is still in service and service is saying it is part of the recall bit gm will not take responsibility. ..
I received a letter in the mail regarding safety recall 15031. There are detailed pictures showing the inspection process, which i performed and found the resulting cuts in the sleeve that are detailed. The letter states that if cracks or cuts are found, stop driving vehicle immediately and gm will tow the vehicle and provide a loaner car. I called a dealer with this information, they referred me to the chevrolet customer assistance center phone number, which when i entered my vin# in the automated system, stated there are no open recalls for my vehicle. I am simply attempting to comply with the recall notice that tells me my vehicle is not safe to drive and i got exactly nowhere.
My husband and were traveling southbound on i-95 around wilmington de.traffic had come to a complete stop, we were at a standstill when we were rear-ended in a five car / two tractor trailer pile up.my husband, seat belted in the passenger seat, struck his head on the dashboard causing a concussion, whiplash, and back pain.his seatbelt failed to lock into place, resulting in him being thrown forward into the dashboard and sustaining the above injuries.
The contact owns a 2012 chevrolet malibu. The contact mentioned that the service engine warning lamp flashed numerous times and also that at times it failed to illuminate. In addition, the contact received notification of nhtsa campaignnumber: 15v269000 (seat belts) and stated that the remedy was not yet available. The dealer did not give a specific date for when the part would become available. The manufacturer was contacted and could not provide an estimated date for when the vehicle would receive the recall repair. The vehicle was not repaired. The failure mileage was unknown.
The contact owns a 2012 chevrolet malibu. The contact stated that while driving at various speeds, the service electronic stability traction control warning light flashed as the vehicles speed reduced. The failure recurred multiple times. The vehicle was not diagnosed or repaired. The vehicle was parked at the contacts residence. The vehicle was also included in nhtsa campaign number: 15v269000 (seat belts) but the part was not available and did not indicate a time frame that the parts would become available. The manufacturer was notified of the failure. The failure mileage was not available. Parts distribution disconnect.
The contact owns a 2012 chevrolet malibu. The contact received notification of nhtsa campaign numbers: 14v252000 (electrical system, electronic stability control, exterior lighting, service brakes, hydraulic, vehicle speed control) and 15v269000 (seat belts). The part to do the repair was not available. The contact stated that the manufacturer exceeded a reasonable amount of time for the recall repair. While driving at an unknown speed, the vehicle shook excessively and stalled in a parking lot. The approximate failure mileage was 60,000.
The contact owns a 2012 chevrolet malibu. The contact received notification of nhtsa campaign number: 15v269000 (seat belts) however, the part to do the repair was unavailable. The contact stated that the manufacturer exceeded a reasonable amount of time for the recall repair. The manufacturer was not made aware of the issue. The contact had not experienced a failure. Parts distribution disconnect.
As time is going on the steering is getting less controllable. I have yet to get into an accident but i can feel the car swerving a bit when i'm steering (swerving i didn't do). I looked up my vin on iseecars.com to see if there was a recall at all with the steering and there was in 2014 . I bought this car last year so i am the owner and am not sure how to go about this. I got it checked out and the mechanic said there is definitely an issue with the rack and pinion and shaft . Also my passenger seatbelt light remains on at all times and there have been minor issues with them.
My car won't go when stepping on the gas peddle in drive. When i stop at the light or to brake the car won't go when pushing the gas peddle in drive it doesn't do anything. I had to have the car towed 2x due to this issue. I only have 67k miles on this car. I've been told it's the transmission problem and need a new one. This should not be happening with the car. This is danegerous and unable to drive at this point. The dealer won't do anything about it. I should still have the warranty of driver train and nothing is being done. I've read several complaints of the same exact car having this issue obviously it's a defect. I want to contact gm about this i was almost killed when my car won't go stuck at a intersection. Also the recall on my seatbelt : steering the dealer is saying no active recalls which there is. I'm getting frustrated with these issues and nothing is being done. I'm reaching out to every entity possible before something happens to me or someone else with this faulty car. The airbag fault like occasionally comes on for no reason at all, then goes off then comes back on. These are issues that the gm needs to rectify. After reading online about the many same issues the 2012 malibu has gm needs to intervene and help the owners get these faults fixed. There are way too many online complaints. [xxx]please helpinformation redacted pursuant to the freedom of information act (foia), 5 u.s.c. 552(b)(6).
The contact owns a 2012 chevrolet malibu. The contact received notification of nhtsa campaign number: 15v269000 (seat belts); however, the part to do the repair was unavailable. The contact stated that the manufacturer exceeded a reasonable amount of time for the recall repair. The manufacturer was made aware of the issue. The contact had not experienced a failure.
The contact owns a 2012 chevrolet malibu. The contact received notification of nhtsa campaign number: 15v269000 (seat belts) and stated that the part was not available within a reasonable timeframe to schedule the recall repair. The vehicle was taken to the dealer in july of 2015 and was waiting on the recall repairs. The dealer did not give a specific date for when the part would become available. The manufacturer could not provide an estimated date for when the vehicle would receive the recall repair. The contact was not experiencing a failure.
2012 chevy malibu on 3rd recall list. 1. Brakes 2. Seat belts. 3. Throttle-position sensor.but you say your not going to repair 3rd item unless i have a problem.
The contact owns a 2012 chevrolet malibu. The contact stated that while driving approximately 40 mph, the lap seat belt failed to tighten and became loose. The vehicle was taken to a dealer where it was diagnosed that the detensioner needed to be replaced. The manufacturer was notified of the failure. The vehicle was not repaired. The approximate failure mileage was 770 and the current mileage was 3,200.
The contact owns a 2012 chevrolet malibu. The contact received notification of nhtsa campaign number: 15v269000 (seat belts); however, the part to do the repair was unavailable. The contact stated that the manufacturer exceeded a reasonable amount of time for the recall repair. The manufacturer was made aware of the issue. The contact had not experienced a failure. Ma 10/22/2015
The contact owns a 2012 chevrolet malibu. The contact stated that while sitting at a complete stop, another vehicle crashed into the contact's vehicle while traveling 47 mph. The air bags failed to deploy and the seat belts did not tighten around the passengers. The vehicle was destroyed. The contact sustained neck and back injuries. The front passenger sustained neck, back and hip injuries. The rear driver's side passenger sustained neck, back and ankle injuries. The vehicle was inspected by the manufacturer however, the seatbelt and air bag failure could not be diagnosed. The failure mileage was approximately 15,000. The vin was not available.
The contact owns a 2012 chevrolet malibu. The contact received a notification of nhtsa campaign number: 15v269000 (seat belts); however, the part to do the repair was unavailable.the contact stated that the manufacturer exceeded a reasonable amount of time for the recall repair. The manufacturer was made aware of the issue. The contact had not experienced a failure.
The contact owns a 2012 chevrolet malibu. The contact received notification of nhtsa campaign number: 15v269000 (seat belts) however, the part to do the repair was unavailable. The contact stated that the manufacturer exceeded a reasonable amount of time for the recall repair. The manufacturer was made aware of the issue. The contact had not experienced a failure. Parts distribution disconnect.
The contact owns a 2012 chevrolet malibu. The contact received notification of nhtsa campaign number: 15v269000 (seat belts); however, the part to do the repair was unavailable. The contact stated that the manufacturer exceeded a reasonable amount of time for the recall repair. The manufacturer was made aware of the issue. The contact had not experienced a failure. Updated 11/09/15*lj updated 1/20/2016pdated 01/29/16
The contact owns a 2012 chevrolet malibu. The contact previously received notification of nhtsa campaign number: 15v269000 (seat belts). The contact had taken the vehicle to terre haute chevrolet (5377 s us hwy 41, terre haute, in 47802) and had the recall repair performed. Recently, the contact stated that upon entering the vehicle, the driver's side seat belt latch anchor detached from the vehicle without warning. Neither the dealer nor the manufacturer had been notified of the failure. The vehicle was not repaired. The failure mileage was approximately 143,000.
The contact owns a 2012 chevrolet malibu. The contact received notification of nhtsa campaign number :15v269000 (seat belts); however, the part to do the repair was unavailable. The contact stated that the manufacturer exceeded a reasonable amount of time for the recall repair. The manufacturer was not notified. The contact had not experienced a failure.
The contact owns a 2012 chevrolet malibu. The contact received notification of nhtsa campaign number: 15v269000 (seat belts). The part needed to repair the vehicle was unavailable. The contact stated that the manufacturer exceeded a reasonable amount of time for the recall repair. The manufacturer was not notified of the issue. The contact had not experienced a failure. Vin tool confirms parts not available.
The service engine light has been on for 3 years. Chevy has been unable to diagnose the issue despite changing out the sensors and clearing the codes. This effects the rest of the engine settings including fuel as it adjusts them based on a default. The rail support for the driver's seat has also broken loose and fallen down which makes the vehicle unsafe to drive. This seat issue was only notice earlier this year.
The contact owns a 2012 chevrolet malibu. The contact noticed that the driver's side seat trac fractured, which caused the seat to move while driving. The failure occurred without warning. The vehicle was not diagnosed or repaired. The dealer and manufacturer were not contacted. The approximate failure mileage was 178,000.
Seat support welds broken prematurely causing seat to move unsafely when vehicle is in motion. If seat welds break while driving, it could cause the driver to lose control of the vehicle and cause a collision. In the event of a collison, drivers seat may come free and be unable to restrain the driver properly.
The weld on a bar under the driver's seat broke while i was driving causing the driver's seat to move forward and to the right. This is a 3 yr old vehicle with low mileage it should never happen and can cause serious injury in an accident. I had a previous malibu and this never happened. Please recall this part. I checked your other complaints and it is common!
The track on the driver's side seat is broken. The seat moves all over and hits the center console. This is very unsafe and is a huge concern. Was told that this is not covered under warranty.
Tamara recall my driver seat has broken welds on the frame where it bolt to the floor and pulls forward and backwards. And there no recall on it the car only has 130k miles and it seems like im not the only on with the issue and it all seems to be happening right around the same mileage
My vehicle was stopped at a traffic light. I was struck in the rear end by a minivan traveling about 50 mph. The drivers seat back broke at the bottom hinged area and left me lying flat on my back, still in the seat. This sent my feet flying straight up causing them to strike under the dash and breaking my toes.
The driver seat weld broke. This is a very well known problem with gm cars and what is it gm is going to do to repair my car? i want it fixed asap as it is very unsafe to drive. I need my car.
Drivers seat has collapsed in the right rear. Seat can not be adjusted with weight on it as it binds with center console.blind spot over left shoulder can not be properly checked due to the body being twisted to the right while seated.seat integrity is severely compromised as the rear right is 'floating' and not attached to the seat framein a collision the seat is likely to rip free of the frame sending the driver into the windshield. Very unsafe situation. Driving fatigue is an issue due to the unnatural position of the driver in relation to the steering and foot controls.
My husband noticed this problem a few days ago. We drive the car everyday to and from work. On this particular day my husband asked if the seat usually lifts a certain way like the right side of the driver seat lifts last, and it kind of tilts to the right. So i was driving to work and i work about twenty minutes from home and the seat started to shift frontward and backward on the right side this is very uncomfortable and it feels a bit dangerous to drive with the seat like this. I would like to know how and why this happened. And i have only had the car since decemberof last year.
Was getting into my parked vehicle, and the seat broke.took it to the dealership, and they said the weld that held the seat to the railing broke.
I was driving and the right side of the driver seat collapsed. After parking the vehicle i became aware that the seat was loose. I began to inspect it and noticed that a bar broke in the seat frame. Since the seatbelt is attached to the seat this is a huge safety issue.
There is a steering recall for my car but not for my specific vin #. I'm having the same issue with mine as well. My racking pinion needs to be replaced.
Passenger low beam headlight keeps failing every couple of months this is a big problem with all chevy malibus. Driver seat back breaks and causes the seat to be unsafe.
While car was parked i got into the drivers seat, then all of a sudden the seat shifted. When i went to re-adjust the seat height/ position. The seat leaned to one side and was loose. I took it to a repair shop who refused to even look at it after i described the issue. I found 3 different websites listing the same problem. It boils down to cracked welds. A car under 7yrs old should not have a failure like this. I drove a 1981 buick century (purchased 1995) with over 87,000 miles and the seats where fine up to when i sold it in 2001. All i can recall is that this happened sometime in 2018. Why has gm and nhtsa not issued recalls. This is a highly dangerous, even fatal flaw in their vehicles.
I bought this malibu new and have maintained it well.out of no where, the drivers seat became loose and wobbly. I simply sat in the drivers seat while in my driveway and noticed it. Upon inspection, the seat frame has broken welds. Metal that holds the drivers seat in place on a 6 year old car is broken! it turns and moves as the driver does. I believe that in an incident, the seat would come out. This seems like a design or weld quality problem. I am told the entire seat needs to be replaced and this is a big and expensive job. I was preparing to let my college age daughter drive this car but now i don't know what to do.
Welds have broken on the underside of the drivers side causing it to lean and tilt to the side. It is unsafe to support a person and could cause additional back injury while driving.
I hit a deer on the drive side and seat broke. It moves when i sit it it and the insurance won't but to have it fix because they state it is a problem that the malibu's have.
Driver seat weld broke at the rigjt rear and left front without being in an accident. I was sitting in the seat and went to adjust it and it broke on the way up, then the left side on the way down. I have seem on the internet that there are several complaints to gm and nearly all are denied to be repaired at dealers cost. This is a safety issue that should be looked at asap.
The seat comes off the metal molding while car is in motion and when you try to adjust the seat it adjusts lopsided and uneven .
There was a recall on the seat belt assembly for my car in 2019 and i took it to davidson chevrolet in watertown ny. They fixed the recall and mentioned it could affect the seat assembly. Shortly after i got a postcard regarding the seat. A few days later my seat no longer moves back or forth. I tried calling and they said it was a fuse and they had to order it. I kept calling every few weeks and they wouldn't give me an answer or call me back. I finally got ahold of someone and went into the shop thursday july 30, 2020 to get the fuse in. They later came out and said it was because my lever broke, however my lever was not broke when i brought my car in. It looks like it is a clean cut. Then they turned around and said that it was the buckle assembly and proceeded to tell me to go to the junkyard to replace my seat and then i can pay them to install it. I feel as though i should not have to pay for it as it was originally from the recall. I also feel like i shouldn't have to go to the junkyard when they should be fixing it.
The weld on the drivers side seat has broken making the seat unstable. I was getting into the car and heard it snap then fall toward the middle of the car. This is a safety issue and gm needs to take care of the problem and not charge people $1000+ to fix it. The car has never been in a major accident, only a minor rear end collision that did minimal damage to the rear bumper.
Driver's seat suddenly became wobbly and leans to right side.noticed bar in underneath frame of seat has broken at a weld, making the driver's seat very shaky and unstable when driving.this is a common problem with this style of malibu seats and a very costly repair.this issue should provoke a recall and replacement by gm.
Drivers seat collapse in rear frame and is loose from frame. Seat is powered and no longer can be adjusted to desired position. Safety issue that should be on recall based upon the number of complaints to nhtsa and internet. Vehicle was stationary when setting down into seat and then seat lurched down and to the right in the back side of the seat.
Drivers seat became disengaged at the weld point underneath the seat while i was driving. Took the vehicle in and the dealer rewelded the seat. Picked the car up had it for less than a week seat pretty much disengaged from the bottom and the back while i was driving on a highway. While gm offered some assistance i am still out$500. For both repairs. After researching on line it appears other people have had similar complaints with this model year. Serious safety issue!my vehicle was never been in any accident that should have caused this problem. I've owned numerous cars and have never had a seat disengage. I truly believe this is a defenct in the vehicles seat frame.
Driver seat mount has broken at weld causing the seat to slant toward the center console. Very uncomfortable ride and feels very dangerous considering the seat now bounces up and down on that side of the seat when driving. Adjusting the seat with the power controls only makes it worse as it pushes harder against the center console. I have spoke to several dealerships and none are willing to do warranty work. I am not a big person and the only driver of the car. I have heard this is a common problem in this vehicle.
I sat in the driver side seat and the seat completely broke on the right side.i'm now sitting slanted and being squashed against the middle console/arm rest.whenever i get out of the car, which is very hard to do and drives me bat crap crazy, i feel i need a crane.sitting slanted is very uncomfortable and is very hard when judging making turns/parking.
Driver side seat is broken and the frame is cracked on the right side which makes it lean towards the middle console. Which causes my seat to be crooked and definitely feels unsafe and worries me that the airbags may not deploy if ever in an accident.
Driver's seat bracket on right side has broken and seat is wobbly and leaning on the center console.this appears to be a common problem with the 2012 malibu (and other years) and isn't being covered by warranty.many people are saying this is a $1000 repair at the dealer.this is an unsafe condition and needs to be recalled-- consumers shouldn't have to pay for this defect.
The driver side seat bottom portion left side caved in it says if the webbing underneath the seat that holds it up it broke and i just wanted to see if it was cause do the recall that was fixed on it or what not because i did read other complaints with the exact same issue i just want to know if there is a investigation or a way to be fixed
My 2012 malibu 1lt has some of the same issues the recalls are for but my specific vin number isn't included in the recalls. My driver seat moves when sitting in it and i need a rack-and-pinion. I'm also having issues with a 'rough' idle and when i put it in park the rpm's die down between 1&0 and the car acts like it's trying to cut off.
The driver side seat is broken. Was riding down the street and it just popped. Now it rocks and bounce everytime you hit a bump or hump in the road
I am just wanting to express my feelings concerning the headrests. I am 5' 4" tall and the headrest is the most uncomfortable thing, it pushes your head forward. If i were hit hard, there isn't support and i would probably break my neck or have a neck injury. . the only remedy, is to turn it around and then you have no support. I do not own this vehicle, it is a rental. I would not buy one at this point.
My engine light came on, so i shut the car down and restarted, engine light went off, however when i pulled out of parking space, i noticed a grinding sound coming from the front of my car, then my breaks starting squeaking really bad. Now i constantly hear that sound when starting my car in early mornings, the squeaking is constant.also my radio and defrost goes in and out, my radio shuts downby itself and then returns on, my back defroster doesn't seem to work, when it rains, my back window is not defrost, so i can't use my back window for viewing when we have heavy rain or extremely cold weather.
2012 chevy malibu on 3rd recall list. 1. Brakes 2. Seat belts. 3. Throttle-position sensor.but you say your not going to repair 3rd item unless i have a problem.
The contact owns a 2012 chevrolet malibu. The contact stated that while engaging the brakes, a grinding noise emitted from the front wheels. The vehicle was taken to the dealer who was unable to duplicate the failure. The manufacturer was not notified of the problem. The failure mileage was 52.
The contact owns a 2012 chevrolet malibu. While driving at an unknown speed, the vehicle began to decelerate. Approximately five seconds later, the engine lost power without warning. The vehicle was taken to an independent mechanic where the failure could not be diagnosed or repaired. The failure recurred and the brakes failed to function properly. The vehicle was taken to another independent mechanic and a dealer, but they could not diagnose the failure. The vehicle was not repaired. The vehicle lost engine power, but the headlights and air conditioning still functioned. The manufacturer was made aware of the failures. The failure mileage was approximately 110,000.
Purchased car from ed bozarth on october 12.within 1 week the brakes were grinding and you had to step on it hard for it to brake.have changed brake pads and rotors twice within 3 years.have complained to ed bozarth since i purchased it.i have taken the car to other gm dealerships and complained about the brakes.september 2015 took it to fletcher jones chevrolet and had filed a complain with gm for approval to have them pay for the diagnostics.and again, the dealership and gm claim nothing is wrong with the brakes, but they grind horribly and you have to hit hard on the brakes to be able to brake.another issue is the rubber steering wheel.it is coming apart and it cuts you as you are making right turn.being diabetic it is a health issue.
The contact owns a 2012 chevrolet malibu. The contact stated that while driving at approximately 50 mph, the brake pedal was depressed, the vehicle started to make a vibrating motion, and steering wheel was shaking. The failure recurred multiple times. The vehicle was taken to a dealer where it was diagnosed that the brake pads needed to be replaced. The vehicle was repaired, but the failure recurred. The vehicle was not repaired. The manufacturer was notified of the failure. The approximate failure mileage was 12,000.
Takata recallwhen i'm driving my vehicle, the headlights flicker as if i'm the police. I took it to firestone and they told me to take it to a dealer the car only has 160,000+ and it just startedevery time i accelerate or drive it does this and i'm afraid that i will either get pulled over by the police, hit someone or someone hits me or/and the lights go completely out while driving at night. Is this due because whenever you have to change the build, the whole bumper has to come off to replace it? i like my car but this is a serious issue that needs to be addressed. I see a lot of complaints regarding this
The contact owns a 2012 chevrolet malibu. While driving 30 mph, the brake pedal was applied, but the vehicle failed to respond. The brake pedal traveled to the floorboard without warning. The contact crashed into the rear of a nissan titan. The air bags did not deploy. There were no injuries and a police report was not filed. The vehicle was towed to an independent mechanic. The local dealer was not contacted. The vehicle was not diagnosed or repaired. The manufacturer was notified and opened case number: 8-3918629379. No further assistance was provided. The failure mileage was approximately 80,000.
The contact owns a 2012 chevrolet malibu. While driving at approximately 45 mph, the service esc and service traction warning indicators illuminated. On one occasion, the vehicle did not shift out of the park position. The vehicle was taken to a dealer, where it was diagnosed that the brake modulator sensor needed to be replaced. The vehicle was repaired, but the failure recurred. The manufacturer was made aware of the failure and stated that the vin was not included in nhtsa campaign number: 14v252000 (electrical system, electronic stability control, exterior lighting, service brakes, hydraulic, vehicle speed control). The failure mileage was approximately 19,000.
The contact owns a 2012 chevrolet malibu. The contact stated that while driving approximately 30 mph and while pressing the brake pedal to slow the vehicle down, the electronic stability control sensor light suddenly illuminated and the brakes failed to engage. The contact indicated that once the esc sensor light turned off the brakes operated as normal. The vehicle was taken to the dealer who was unable to diagnose the failure. The manufacturer was not notified of the problem. The failure mileage was 60,000.
Esc & traction control warning light comes on when the vehicle comes to a stop,but goes away after 15 mph also rough idling.anti lock brakes disengage not working at all.engine disabled warning light car won't start.after a short while it will start
The contact owns a 2012 chevrolet malibu. The dealer informed the contact that the vehicle was previously repaired under a manufacturer recall for the brake control module. The vehicle was taken to an independent mechanic who confirmed that the manufacturers recall was not completed due to the old brake module still being installed in the vehicle. The contact had not experienced a failure.
The contact owns a 2012 chevrolet malibu. While driving 65 mph, the steering wheel seized. The brake pedal was depressed, but the vehicle failed to stop. As a result, the contact lost control of the vehicle and crashed into a guardrail. The air bags deployed. The driver sustained minor cuts, bruises, and wrist injuries that required medical attention. A police report was filed. The vehicle was not diagnosed or repaired. The manufacturer was not notified of the failure. The failure mileage was 52,979.
While driving a person slammed on brakes in front of me and i too hit mine. I did not feel the antilock while braking and after impacting with the car in front of me the airbags were not released. For as hard as we hit and for as much damage happened the police were surprised they did not deploy.
P2138 throttle/ pedal position sensor second time same problem the power was reduce when i was driving in the highway.
Traveling about 40 miles per hour on i-17 sb in phoenix. Vehicle in front of me hit brakes suddenly. When i slammed on my brakes,it didn't feel like my brakes were working properly. Brake pedal went all the way to the floor, didn't seem to be stopping car. Felt like there was an issue with the brakes.
I was driving to work and the service traction light control illuminates and then it also read engine power control. The roads were clearand there were no issues with the drive. I was the only person on the highway and no issues. I had to then drive 30-40 miles per hour on the road, even when i drove into town there were cars passing me. Uphill the car went as low as 23 miles per hour. When the car was idle at a stop sign or intersection the car would shake but it stayed on. As i pushed on the gas to speed up the vehicle would jerk.
On two separated occasions i have had to make a hard stop. After these stops my brakes become very soft and low. I could not drive on freeways or highways because my brakes were too weak and too low to stop the car at those speeds..after the first occasion in march, thebrakes were unable for a week before they reset to normal use.after the second occasion(happened first week in april 2014) the brakes were unable and did not reset to normal until may 5th 2014.the fact that my bakes are defected puts me and my passenger, and other drivers at risk, and not knowing when and where this may happen again makes me very nervous knowing i may be in harms way at any time. If you have any suggestions for resolving this problem, please let me know.
While driving on the highway i used the cruise control. I stepped on the brake to slow down but the brake would not release. It frightened me, i stepped on the brake harder it still did not release i had to press off the cruise control button on the console. This happens all the time now. It is an inconvenience and scary.
I brought my vehicle into a chevrolet center near me to have a 'manufacturers warranty fix' done to my vehicle on 04/17/2021, as the power steering had failed and i was able to get this fixed for free. When i turned my vehicle on and noticed the power steering notification on my dash, i tried to back my car out of where i was parked and move my wheel, but could not move the wheel. When the part was replaced, i was told that there were still sensors on my dash indicating that i needed the esc and stability traction control serviced for my car. According to the chevrolet dealership, this had 'nothing to do with the special policy fix' and not something they would be fixing for me. After checking the nhtsa.gov for any recalls on my 2012 chevy malibu, i found one from may 2014 that described exactly the problem i was having with my vehicle: loss of vehicle stability traction control, cruise control and random illumination of brake lights. I contacted chevy once again about this recall, to which they said there 'was no recall for the vehicle, and if there was it was already fixed'. Not only was this completely unprofessional and lacking concern of safety for my child and i, i do not know where to turn to for this to be remedied. Attached is the ticket for the initial fix i had done.
"takata recall"if i hit a bump small or any size actually my engine reduces and i have to pull over...and turn the car off for up to 10 mins sometimes...i cant drive on the freeway at all because i dont want the engine to reduce while doing 60 mphlately it will go into engine power reduce while im parked in a driveway so i dont get it
The check engine line and service traction light continues to come on. My car was serviced by 2 chevrolet dealership and another dealership and they problem has not been fixed. I was told it was the coils by manassas chevrolet and lindsey chevrolet . The coils, spark plugs and carbon blow out was completed. The lights continue to come on. It appears to be the same issue that the 2009 malibu was recalled for. Please make chevrolet complete a recall on these vehicles before someone is seriously engineered. One dealership said the engines may be bad in these cars. The car drives rough and the service traction light comes on when you brake. The check engine light stays on at all times.
When driving, at low speed in the city, or on the highway at speed, power steering and power brakes intermittently fail without warning (according to the repairing dealer, vehicle is unsafe and should not be driven); dash gauges go on and off; traction control and electronic stability control turn ownand off without warning; dash lights go on and off without warning; bells and buzzers ring; door locks cycle, and theft deterrent warnings illuminate. Dealer has attempted multiple times to repair it by replacing the body control module. It is at the dealer service department now, has been there for a full week and at this point is still unsafe
All lights on the dash board had brake pads installed vehicle making noise while driving vehicle pulling to the right, had three sensors replaced dash board light still on05
Was driving in the rain, vehicle does not handle well in inclement weather. Has issue with braking, tires skid.when i hit the gas pedal after a stop, the tires skid. . recently has a alignment done, and the tires are in very good condition. Thought maybe that was the issue, i was wrong.vehicle had recent inspection "brakes are in very good condition. Vehicle has had issues since purchase.my family and i were belted in as always, while driving the dash console light came on "service air bag" the light stayed on constant for approx. 30 min then went out. I have called the dealer and will have vehicle checked at appointment in 2 weeks.
The center brake light doesn't work. I put in a new led light assembly in and it still doesn't work.
My car was involved in an accident where my friend applied the brakes and was forced into hydroplaning into a barrier, another vehicle and a person. My airbags did not deploy as the sensor was not hit nor did the onstar become alerted that the vehicle had been in an accident. After fighting with insurance companies, my car was totaled then declared not totaled, and repaired. I received the notice of a recall much later after the car was in the accident.
The contact owns a 2012 chevrolet malibu. After driving various speeds and depressing the brake pedal, the entire instrument panel illuminated and flashed intermittently. The vehicle was not diagnosed or repaired. The contacted called an unknown dealer who stated that the bcm brake sensor module would need to be replaced. The vehicle was not repaired. The manufacturer was notified of the failure and stated that the part would be replaced. The vin and failure mileage were not available.
Tl - the contact owns a 2012 chevrolet malibu. The contact received notification of nhtsa campaign number: 14v252000 (service brakes, electrical, etc). The contact stated that the parts to complete the recall repair were not available and the contact was concerned of the safety hazard involved. The contact wanted to know when the parts would become available and stated that it was abnormally long for recall repairs. The manufacturer was made aware of the delay. The contact had not experienced a failure.
I have a 2012 chevy malibu i bought it in 2014. I have had the esc light come on in 2016 but no problem with it untill now of this year in 2022. Not knowing the problem i have already put alot into it. I took it to a machanic they told me it was the rack and pinion. So got that done . Apparently it wasn't it took it to another machanic they told me it was struts got that done too n still nothing so i looked it up online got cv joint, inner ,tie rod, wheel alignment. All those done n still nothing fix it. I didn't know what else to do until i made more scratch on my vehicle and i found that it could be a recall .
I'm having problem with brake pedal sensor -replaced twice already - while drivinghit brakes error message service abs service traction cruise control want disengage also noticed that i could move the gear out of park with out pushing the brake pedal are there any recalls for these issues?
Driving and car had severe electrical problem that caused the car to randomly stall while driving. We lost power steering and power brakes. The instrument panel starting going crazy displaying all lights, saying device esc and the doors locked and unlocked. The engine stalled and transmission started jolting around. The car would not turn back on after turning it off. Took the car to starling chevrolet to get it fixed the following monday since closed sunday. Before taking to the dealer took the car to auto zone to check the battery. Autozone stating battery was great. Chevrolet didn't look at the car at all monday, and tuesday stated we need new battery. I advised of auto zone reading and was told autzone was wrong. Picked up the car tuesday after having a brand new battery put in for $270. Today is the following friday and the car did everything again while driving and will not start. Now i have to tow the car to chevy again.
The contact owns a 2012 chevrolet malibu. The contact stated that the electronic stability control and the service traction warning lights illuminated and the chimes sounded. The contact mentioned that the failure occurred on five occasions. The vehicle was taken to a dealer, who re-calibrated the brake pedal pressure sensor. The failure recurred and the vehicle was taken back to the dealer where it was diagnosed that the brake pedal needed to be replaced. The vehicle was not repaired. The manufacturer was made aware of the failure. The approximate failure mileage was 12,000.
The contact owns a 2012 chevrolet malibu. The contact stated that recall nhtsa campaign number: 14v252000 (electrical system, electronic stability control, exterior lighting, service brakes, hydraulic, vehicle speed control) had exceeded the reasonable amount of time for repair. The dealer stated the parts were not available for repair. The manufacturer was made aware of the delay. The vehicle was not repair. The contact had not experienced the failure. The vin was not available.
The contact owns a 2012 chevrolet malibu. The contact stated that the emergency brake foot lever failed. The contact mentioned that when the foot lever was depressed the emergency brake would not engage. The vehicle was taken to the dealer who replaced the emergency brake lever. The remedy failed to correct the problem. The vehicle was not repaired. The failure and the current mileage was 2,255.
The contact owns a 2012 chevrolet malibu. The contact received notification of nhtsa campaign numbers: 14v252000 (electrical system, electronic stability control, exterior lighting, service brakes, hydraulic, vehicle speed control) and 15v269000 (seat belts). The part to do the repair was not available. The contact stated that the manufacturer exceeded a reasonable amount of time for the recall repair. While driving at an unknown speed, the vehicle shook excessively and stalled in a parking lot. The approximate failure mileage was 60,000.
Since buying this vehicle, i've had trouble with the brakes, airbag sensors, electrical problems, seatbelt issues and also the airbag light, had a mechanic replace the airbag sensors in the rear, but the light still comes on. The brakes are now shuttering worse when i apply the brakes and it feels like the wheels are going to fall apart.
"service esc" light illuminates when making sharp turns, slowing down on the interstate, as well as breaking in bad weather. After replacing brakes twice and rotors once i scontinue to experience this problem . After a recent inquiry i learned of a recall on "service esc" as well as "traction control".
The car tells me to service esc and to service traction. When the car is in cruise control the brake does not disengage cruise control.
When i purchased this vehicle from mac haik chevrolet in 2012 with 30miles on it. It drove great for the first 3 months. Then when i would reverse the car to leave i would here a noise on the right rear of the car. So i took off thinking it was the rain that caused the noise on the brakes. Then sometimes i would hear it when i start slowing down. I took the car to the dealer ship they told me nothing was wrong with the brakes. So i left every morning i would hear the same noise for the next 6 months i took it to a garage where they check the brakes for free. They looked at the right rear brake rotor and they told me it had a groove on the rotor caused by something with the brake system. It could be a bad brake pad. They told me to take it back to the dealership so i did. All they told me was it's not that bad and that there's nothing they can do about it. I had the garage check the rest of the brakes they had no grooves at the time i took it in. It's 07/16/2014 and still have the same problem. I called them to see if there is a recall on my vehicle and they said no. Please help me or let me know what i can do.
Vehicle high mount third brake light failure after 60,000 miles. May affect visibility when stopping.
Vehicle has random loss of electronic steering assist, which leaves no power steering. Also service abs, esc and traction warning lights, eps causes vehicles steering wheel to shake without vehicle being in motion.gm recalled thousands of malibu's in feb. Of 2015 for eps issues but my year is not included. Coincidence? highly doubtful. Vehicle it's scheduled for diagnosis on wednesday. Car was repaired for an earlier recall concerning brake systems.
2012 chevrolet malibu. Consumer writes in regards to multiple safety defects with vehicle. *ldthe consumer stated the vehicle has several safety defects including the electric stability control, brakes, sensor lights, steering, suspension, wheels, engine lights, power train. Updated 10/23/2017
The contact owns a 2012 chevrolet malibu. The contact received a recall notice for nhtsa campaign number:14v252000 ( electrical system , electronic stability control , exterior lighting , service brakes, hydraulic , vehicle speed control) and stated that the part needed was unavailable to perform the repair. The manufacturer was notified of the issue. The contact had not experienced a failure.
Gm tech bulletins say there is a ghost problem with elect. Stability controller.gm mentions there is no recall or known cure for this..components/contacts were cleaned at serv.shopbut " serv. Esc-esc off"keeps appearing in "driver display"when hitting bumps -turning car.. I will mail service sheets. This option was available on 08-09-10 models of malibu but std. Onmy 2012 car.it is worthless when there is thick snow..i will send , by mail, serv. Records on this unsolvable problem...it continues to happen ,at slow speed -not just one time...i believe you can read the g.m.-tsbs, as it was shown to me....
The car had gm service bulletin 13036 (recall campaign 14v252) performed on september 19, 2014 and the car is experiencing the exact same conditions as described in the service bulletin[1] so the "fix" didn't resolve what is now an on going safety issue.it should be noted in the recall "why" section to owners the use of "...over time...".therefore, the issue is known to be time dependent and the fix doesn't appear to fully resolve the issue into the future.1: we are currently seeing the following conditions:- service brake lamps may not illuminate when the service brakes are being applied.- ifcruisecontrolisengaged,additional service brake pedal travel may be required to disengage it.- traction control, electronic stability control, and panic braking assist features, if equipped, may be disabled.- service esc and/or traction control tell-tales may illuminate with this condition.
At approximately 9am on aug 18, 2014, the brake system started to fail. Driver noticed that when brakes were applied it make a loud noise coming from the front end of the vehicle. Issue continued for the next few miles where it took an excessive amount of pressure to get the brakes to engage. Pedal goes almost all the way down to the floor to get any braking action.
Was driving on lake shore driving when i had to slow down only to have to push the bakes down to the floor and that should not be. This has happen a lot and i have not had this vehicle for a year yet. Now i'm scared to drive my car.
The lights randomly come on then the antilock brake system will start to act up when i go to stop as if i was to slide on ice but i'm not i'm on dry pavement. On city street.
I was reaching out to you because of this recallletter that i received on my car. Recall 13036. I believe that i was sold a lemon. It should not be my responsibility to cont. To make payments on a car that is not at the quality that i believe i was purchasing it at. I would like to see one of two things done. You guys take over the payments until this car can be repaired or i be upgraded to a 2013 at no additional cost to me.the law requires a manufacturer to repair the defect, replace the vehicle, or refund the purchase price of the car minus the depreciation . I'vebeen to the dealer they said they could not repair it because they have no parts and gm does not even know when they will get the parts. I should not have to put the safety of my family in danger because of this recall it's unfair to me as a consumer.can you please contact me asap. Thanks
Vehicle (2012 malibu) was purchased april 2012 - starting july 2012 vehicle would stall going down the road, with loss of engine, power assist steering and power assist brakes. Dealer replaced numerous modules, but it occurred again in sept 2012 (3 times) then again in january 2013. Two body control modules have been replaced, engine control modules, two power steering modules, onstar module, transmission control module, etc. Unintended power steering assist occurs such that within approximately 5 seconds while driving down the road, power steering comes in and out as module fails (along with engine and transmission). Very unsafe to drive. Dealer would not replace vehicle and gm states they stand by last repair. It has been repaired 6 times now, but we refuse to drive vehicle, as we believe there must be a short somewhere. They keep stating it is defective modules and they just keep replacing them. Please see youtube videos: "2012 chevy malibu - unintended power steering assist failure mode?""2012 chevy malibu dangerous electrical problem - any ideas?"
On numerous occasions, when i'm approaching a yellow light and/or a car that's in front of me while only driving approximately 20mph, when i attempt to apply my brakes i have to apply a lot of pressure to get my car to slow down and it honestly feels as though my car isn't going to stop. I would hate to be driving my car one day and my car doesn't stop and i'm involved in a car accident that leaves me severely injured or takes my life and/or someone else's life as well. Also, many times i have to apply a lot of pressure to my gas pedal in order for it to accelerate and actually move. I understand that my vehicle has been recalled and the dealer is waiting for gm to provide them the parts in order to repair my vehicle, but i don't think my life should be at such risk while waiting for gm to receive parts. Am i suppose to just keep driving around hoping my car doesn't give out on me in the middle of the road even though there is a known extreme safety hazard with my vehicle? my life is more valuable than that. Could i be provided a rental vehicle until gm provides the parts to repair my vehicle? or could i be refunded for my vehicle? seeing that there has been numerous car accidents and serious injuries related to this particular defect within the vehicle, i should not be driving my vehicle until it is fixed. Otherwise, i could be the next person involved in a serious car accident. So in closing, i would like to know if i could be placed in a rental car until my car is repaired or refunded for the price of my vehicle?
I was driving home from work with my wife in the passenger seat and upon approaching a red signal at an intersection i felt a vibration under my foot as i came to stop. I thought it may have been uneven road conditions or something in the road and disregarded it. Later that day, i felt the same vibration as i had stopped and heard a noticeable grinding noise. I went to the dealer where i had purchased the vehicle to have it inspected and they could not duplicate the issue, nor could they find a root cause. Over the course of the next 8 months, the vibrations had gotten worse and more frequent. The vehicle has been serviced 5 times for the issue and the problem still exists worse than ever. One dealer, which i have returned to on multiple instances for this problem, was able to duplicate the issue, smell a noticeable aroma of burning brakes, identify i had a serious brake problem, but were not able to determine the cause for the failure, thus not correcting any faults. It has progressed to the point where the pedal will go almost down to the floor before the brakes will engage. It has almost caused several accidents due to the failure and the vehicle is no longer safe to drive. The mileage of the first failure was about 6000 miles and it currently has 16,000 miles on the vehicle with no resolution. Several online searches yield the same issue on the 2008-2012 chevy malibu as well as the 2008-2010 saturn aura which share the same platform.
I got a recall on my car and was told by my dealer, best chevrolet, my vehicle was not on the recall.then i receive a second notice along with a reimbursement form.i just want you to know i don't feel very comfortable driving around in a car that may be a accident looking for a place to happen.
Warning on dashboard service traction control when applying the brakes. Brake lights does not come on when the service traction control come on. There has been a recall on this issue previously and issue still occurring.
My car has been making a horrible sound for a couple months now and the last week it's gotten really loud when i go over 20 it sounds the worst of slow down i can't go over 40 without it sounding like it's taking off and my front end shakes like my tires gonna come off i replaced the breaks and it's still making the sound it's to the point i can't drive my car because i don't want it to die on me my battery has been dying a lot and my service esc light comes on and goes off please can someone tell me why my car is doing this or an idea it sounds like an airplane that's the best way i can describe it and my right rear tire is always saying my tire is low i rotated my tires and it's still not reading it right there brand new tires to boot please please help me
I was driving at 60 mph in cruise control on a straight road. An ambulance was heading towards me so i stepped on the brakes to slow down and pull over and the car accelerated very quickly. This was a very dangerous situation because i was moving towards the shoulder of the road because of the oncoming ambulance. I had to turn off cruise control to be able to apply the brakes. The brake lights are also not coming on when i apply the brakes. The problem with the lighting happened previously and was repaired on 04/28/2015. I thought the problem was included in recall #13036 but i was told that it was a problem with the brake switch and was not part of the recall however when i look up the recall numbers on my vehicle this recall number does not show up as still needing to be done. I paid for the repair and i am now having the serious problem of the brake lights not working again plus the even more serious problem of the brakes not working when i am in cruise control. I do not know how to proceed with having this problem corrected. The recall problem has not been repaired correctly or there is another problem that is occurring. I have attached a copy of my receipt of the repair that was done on 04/28/15.
This is the second time that i pressed the brakes and the car failed to stop.both times resulted in collisions.the first time the car wss repaired and then given back to me.this time i was traveling approx 45 mph and the person in front of me slammed on their brakes.i went to do the same and the brake pedal went to the floor without stopping the car at all.i collided with the car in front of me causing major damage to my car and injuries to my shoulder, neck and back.
The contact owns a 2012 chevrolet malibu. While driving 30 mph and attempting to stop for traffic, the brake pedal was depressed, but failed to respond in time. The contact's vehicle rear ended another vehicle. The air bags did not deploy. A police report was filed and there were no injuries. The vehicle was towed to a body shop, but the cause of the failure was not determined. The manufacturer was notified of the failure. The failure mileage was approximately 70,000.
The contact owns a 2012 chevrolet malibu. The contact stated that while traveling 15 mph, he tried to apply the brakes at which time an excessive amount of effort had to be applied and a loud cracking noise could be heard coming from the front end. The vehicle was driven to the dealer where the failure could not be replicated. Several repairs had been made to different components of the vehicle but to no avail. The manufacturer was contacted about the issue. The failure mileage was 1800 and the current mileage was 13,100.updated 2/15/13 the consumer stated the failure was replicated around 10/3/12 by service manager and their mechaniccould not find the cause. The general manager advised the vehicle was safe to drive. As of 1/17/2013 the vehicle had not been repaired. Updated 02/20/2013
Brake light malfunction, difficulty moving the gear shifter out of "park", ecs and traction control lights going on-and-off. These are the exact same issues occurring in the 2014 recall (we had to about 3 months to get into the dealer back then). Bottom line is the problem has not been corrected, my car is unsafe to drive and the dealer said they can re-fix the problem for a lot of money as the recall is no longer valid because "they fixed it" on november 28, 2014.when we called gm (may 19, 2016), the operator said she shared our frustration but could only speak to the dealer about it.(amazingly, the dealer did not respond to her).in reading forums and speaking with the gm operator, appears that gm does not have a permanent fix for the issue. So the recall did noting to solve the issue.in the meantime, we await a decision/call from the dealer/gm.the gm operator did offer a voucher for service analysis for use at a dealership - but not for a fix.we are looking for resolution to the issue.the car is unsafe to use.
My son was driving my car down a two lane highway. It had been misting rain and the road was slightly damp... Approaching an intersection he reduced his speed to approx 40 mph. Two cars ahead of him slammed on breaks when the light changed to yellow. This caused a chain reaction... Cars sliding to prevent hitting the first car. My son said that he was breaking very hard when the anti-lock breaks engaged... They pulsed 3-4 times and then released which shot him straight into the back of the truck. He said that he was pushing the break as hard as he could when this occurred.the air bags did not deploy nor did the automatic crash response system work. I called on star to see if the system even shows a crash and it doesn't. I think that considering the crash bent the frame in the front end and is in excess of $6,000 you would think the sensors would have picked up on something. After the crash i contacted my dealer to ask if there were any recalls on this issue and was told there were not. I am very thankful that this crash did not result in a more serious injury / death.
I recieved a notice from gmconcerning the body control module (bcm) warning me that my brake lights could malfunction, but warning me not to take my car to the dealer because of this warning.now i have talked to an insurance representative a member of my family who happens to be a lawyer also a member of the police dept and i have been told that since i got thois warning that makes me aware of a serious, dangerous and possibly a deadly defect in this automobile, therefore if i was in an accident and some body got killed, not only would it be my fault, but in fact i would and/or copuld be charged and found responsible and charged with that death.not only that, but in fact my insurance company could leagally and therefore would possibly pay ffor any damages period.now, since i have had this car, i have recieved a simaliar notice about the steering machanism on this car to which i was told the same thing,a recall on the seat belts, a notice about the headlights on this car and if i am not mistaken an earlier notice about to headlights. So everytime i drive this car, i am not sure that i will accidently have a wreck,kill someone or even be killed myself; i have contacted the nhtsa about this problems previouslyabout some of those deadly defects, yet this car is still allowed to be on the road, so why,why, why, why hasn't this company been forced to recall this dangerous safty hazzard vehicle ??when even though on the top of this letter, it's dated "march 2017" yet i didn't recieve this letter until may 2017/
The contact owns a 2012 chevrolet malibu. The contact had the vehicle repaired under nhtsa campaign number: 14v252000 (electrical system, electronic stability control, exterior lighting, service brakes, hydraulic, vehicle speed control); however, the failure recurred. While driving approximately 45 mph, the traction control warning indicator illuminated. The vehicle was taken to a dealer where it was diagnosed that the bcm module needed to be replaced. The vehicle was not repaired. The manufacturer was notified of the failure. The approximate failure mileage was 22,000.updated 02/12/16*ljthe consumer has since sold the vehicle. Updated 02/22/16.
Do not remember when i brought my car in for campaign 14v252000 maybe approx. A year ago. The problems the car was having before i had the recall done have started again. Up until now haven't had any problems. My dealer wants to charge me to fix it.
2012 chevrolet malibu.consumer writes in regards to body control module recall notice.the consumer stated while driving, the airbag deployed and caused him to have an accident. The consumer was injured.the consumer sent in a recall notice along with his complaint.
The contact owns a 2012 chevrolet malibu. The contact received a notification for nhtsa campaign number: 14v252000 (electrical system, electronic stability control, exterior lighting, service brakes, hydraulic, vehicle speed control). However, the part needed was not available. The dealer indicated that it would take months before an appointment could be scheduled. The manufacturer was contacted and could not provide an estimated date for when the vehicle would receive the recall repair. The contact did not experience a failure.
2012 chevrolet malibu.consumer writes in regards to body control module system/ brake apply sensor recall notice.the consumer stated he waited for the details to restore the safety of the vehicle. However, unable to wait any longer, he was forced to sell the vehicle.
2012 chevrolet malibu. Consumer wants to be reimbursement for repairs due to recall for vehicle. *ta
The contact owns a 2012 chevrolet malibu. While driving 70 mph, the vehicle experienced acceleration failure and stalled. In addition, the gear had a difficult time shifting from park into reverse or drive when attempting to move out of a parked position. The vehicle was taken to bergstrom chevrolet of madison (1345 applegate rd, madison, wi 53713, (608) 271-2212) where it was diagnosed that the body control module and an electric brake control module needed to be installed. In addition, a rear passenger side wheel speed sensor alternatorcircuit needed to be installed. The vehicle remained at the dealer since july 16, 2019 and the contact was informed that the repair would cost $2,700. The manufacturer provided a case number and referred the contact to a manager. The contact had not yet spoken with the manager. The contact was trying to find out what repairs were completed by the previous owner and was concerned that the repairs were not done properly. The dealer could not provide a service repair history for the vehicle. The failure mileage was unknown.
The contact owns a 2012 chevrolet malibu. When the contact attempted to depress the brake pedal, the vehicle failed to stop. The dealer stated that the front rotors and brake pads needed to be replaced. The vehicle was repaired and the manufacturer was not notified. The failure mileage was 42,700.
The contact owns a 2012 chevrolet malibu. When the contact attempted to depress the brake pedal, the vehicle failed to stop. The dealer stated that the front rotors and brake pads needed to be replaced. The vehicle was repaired and the manufacturer was not notified. The failure mileage was 42,700.
While driving, car's power steering turns off. A message stating that service to esc appears.
My vehicle is starting to show a power steering warning.there is a recall for this number 15356, 08/28/2015, campaign - electronic power steering failure warranty info. I called gm and they said my vin number is not included. I feel it is going to lose power steering assist at any time. This could result in a serious accident. This is obviously the same problem as the malibus covered by the recall. They refuse to admit this problem is more widespread to 2012 malibus that are not included at this time.
Rack and pinion failure causing play in the steering, pull to one side, clunking and rapid shaking of the steering wheel when braking.
I was driving my children to school, when without any warning my power steering went out. I almost got into an accident!!! it was very abrupt. A message saying "power steering" "service esc" came up. I immediately took it to the dealership, where i still have a warranty and i was told they would have to do a diagnostic check on it (150.00) before they could let me know if it was covered under my warranty. I come to find out that earlier models of the malibu were recalled for this very reason. I would recommend that you check this problem out very seriously on the 2012 model before someone gets killed!!! i had all i could do to steer the car manually! my children and i were very lucky that we didn't end up in an accident. The next person might not be so lucky. Before chevrolet gets sued, they might want to look into this problem. My children also drive this car. Unlike me, who knows about manual steering and was able to deal with the problem, young adults have no idea what manual steering is. My daughter drives this car on the expressway. I can't even imagine what would have happened had this occurred while she was driving. I thank god that i was behind the wheel at the time. I did contact gm and they are helping me rectify this problem.
I bought a 2012 malibu for my daughter who is 15 years old.nice car, but when she was pulling into a parking lot, "service etc" illuminated on the dash and she completely lost power steering.hit a curb.
I was driving my car a few days ago on a city street and after i made a turn,the power steering service esc light came on as well as the traction control picture. My steering wheel got super stiff and it was extremely hard to turn it. After i pulled over and turned my car off, i turned it back on and everything went back to normal. There is a recall for this but i checked on the gm recall website and put in my vin but my car is not included in the recallwhich doesn't seem to make much sense if other 2012 chevrolet malibu's have been recalled because of this.
The contact owns a 2012 chevrolet malibu. While driving approximately 35 mph, the power steering failed and the traction control indicator illuminated after the failure. The vehicle was not diagnosed. Neither the dealer nor the manufacturer were notified of the failure. The vehicle was not repaired. The vin was unknown. The approximate failure mileage was 170,000.
Power steering failure. Power steering motor/module needs to be replace.
"takata recall " im having problems with my 2012 malibu when im driving down the street my vehicles steering wheel locks up and " service esc " pops up making it hard to turn so i have to stop in the the middle of the street to restart my car it happened a month and a half ago and just recently started again it stopped for a day and now its back even worse. Took it to the repair shop the think its my torque sensor and intake and exhaust camshaft
Esc warning on dash coming on will driving and turning forward or backward. Hvac controller not responding to commands,hvac resistor and blower motor wires getting very hot and not blowing fuses when driving with ac or heater running. Hvac resistor blowing out. High motor oil consumption , every 1000 miles its low a quart.
While stopped the steering wheel begins to click, shake, and move on its own. This continues to happen even worse while driving on the highway making it harder to control the vehicle. There are no lights on. Mechanic believes it may be the sensor in the motor for the power steering but isn't sure.
My power steering just went out on me in the middle.of driving got real stiff on the 10 freeway going home from.redlands to hemet and my power steering eis electrical and its hard my mechanic said its too much to fix and told me that its a high demand in recall for this and that i need it fix i turned it on and ti works for 5 minutes a drive or two and out of no where even while driving will stiffen up again on me
Wanted to update my case 11173286. I took the car to chevrolet dealer to have car repaired 02/05/2019. Apparently chevrolet knows they have a problem with the steering because it was covered under a special warranty. They replaced the steering torque sensor and motor part numbers 23232310 sensor kit and 22837369 module.i think this is a serious problem because if it had happened when my wife was driving she would of had a real problem because the steering wheel is very hard to turn. She would not know if you restart the car the steering works again. She probably would just stopped the car where ever she was and cause a traffic problem. Also there was not any warning that steering was going to go bad. It happened to me 5 times before i had it fixed. The problem would any place. I have happen on the street going 45 mph, turning a corner, backing our of my driveway, 2 times on a city street under 30 mph. If you go online there are other people complaining about the same problem.
The contact owns a 2012 chevrolet malibu. While driving various speeds above 40 mph, the instrument panel lighting failed to remain illuminated as the steering wheel seized. The vehicle was towed to lasorsa chevrolet buick dealer where it was diagnosed with an oil pressure valve malfunction. The dealer was also informed that the check engine indicator illuminated. The vehicle was repaired for the oil pressure valve, but the dealer failed to diagnose the instrument panel and steering wheel failures. The instrument panel and steering wheel failure recurred and the vehicle was towed back to the dealer. The diagnosis was unknown. The manufacturer was not made aware of the failures. The failure mileage was approximately 65,000.
The contact owns a 2012 chevrolet malibu. While driving approximately 20-25 mph, the vehicle experienced a loss of power steering and the esc and power steering warning indicators illuminated. The power steering functioned normally after a brief period of time. The vehicle was not diagnosed or repaired. The manufacturer was not made aware of the failure. The failure mileage was approximately 136,000. The vin was not provided.
'takata recall' at start up , a loud noise comes from the left side of the engine compartment . As you drive it , there's a loud noise coming from engine compartment as you turn. Definitely a steering issue. Meanwhile, the esc off, service traction and the service esc warning sign illuminates . The check engine light flashes as the car misfires from cylinder 2. I have changed all spark plugs and the injector to cylinder 2 and the same issue happens. The vehicles has shut off on me as i came to a stop at a red light at an intersection. All these issues occur as your drive the car and go away sometimes, but never for good. This has been an ongoing problem for over a year now
When driving the car the dash will display " esc power steering" and the power steering stops working. Shutting the engine off and restarting the car will turn the power steering back on. For how long? maybe 1 mile or 100 miles. There is no warning that the power steering is going to fail. This has happened while driving on a street, turning and sitting still.
The contact owns a 2012 chevrolet malibu. The contact stated that while driving at approximately 50 mph, the brake pedal was depressed, the vehicle started to make a vibrating motion, and steering wheel was shaking. The failure recurred multiple times. The vehicle was taken to a dealer where it was diagnosed that the brake pads needed to be replaced. The vehicle was repaired, but the failure recurred. The vehicle was not repaired. The manufacturer was notified of the failure. The approximate failure mileage was 12,000.
Loss of steering.traction control light comes on
The contact owns a 2012 chevrolet malibu. The contact stated that the steering column seized while the vehicle was being driven various speeds. Also, the traction control warning indicator illuminated. The vehicle was able to be operated after being manually restarted. The dealer was not contacted. The manufacturer was contacted regarding the failure, but received no response. The failure mileage was approximately 180,000. The vin was not provided.
Takata recall, my cars power steering keeps going out while driving, i have to pull over and turn my car off then on and it will work again. It usually happens at least once or twice a day. The steering wheel does not move unless i use all my strength which is very difficult and scary. It has happened on the highway and on a city street while driving causing me to pull over.
The electronic power steering failed while driving. Service esc light came on and car was nearly impossible to steer. After turning off the engine and restarting the car, the power steering came back on. Now it is going in and out. Sometimes i can steer and sometimes it is almost impossible. I have looked it up and there is a recall for this problem but my car does not seem to be part of this recall.
Stationary steering wheel shakes, esc off light then it's says power steer steering wheel is almost impossible to move
I was driving to town and everything stop working. It scard the crap out of me. I took it to smith chevy in turlock ca they said they didnt know what was wrong with it and charaged me 489.00. Lucky it didnt kill me. Gm motors need to do a recall on it before someone gets hurt or lose there life.
I was driving my car on a city road and my steering stopped working. Thankfully i wasn't too far from home so i did get home safely. I had it towed to a (xxxx) dealership because my mechanic said that my warranty should cover it and that there was a recall. The dealership called me and told me i need a new steering module and column and that it is not covered. If i was on the highway and this happened i would have been seriously injured. I am pregnant and due in a few weeks and i need a safe reliable vehicle for my son and i. Please help us.'parts of this document have been redacted to protect personally identifiable information pursuant to the freedom of information act (foia), 5 u.s.c. 552(b)(6).
Bad steering column parts. Steering wheel shakes when stationary. Sometimes powersteering does not work.
The contact owns a 2012 chevrolet malibu. When the engine was started, the steering wheel failed to turn left or right. The power steering, esc, and traction warning indicators illuminated. The contact turned the vehicle off, restarted the engine, and the vehicle returned to normal. The dealer (southern chevrolet cadillac, 5845 coliseum blvd, alexandria, la 71303) was contacted and confirmed that the vin was not included in the recall. The vehicle was not diagnosed or repaired. The manufacturer was not contacted. The approximate failure mileage was 120,000.
For a long time now, a year, i've been getting the esc warning every time i turn the steering wheel. It just a nuisance alarm. It shuts off the esc. Now however every time i start the car lately and i'm getting the power steering warning, i move the wheel a little and it goes away. I'm afraid it's going to get worse and i'll start losing my power steering. Gm won't do anything about it because they say the vin number isn't part of the recall. I have a 2012 with the 2.4l. It has 73,000 miles on it. The recall if that's what it is (# 15356: special coverage adjustment - loss of electric power steering assist - (aug 28, 2015).*dt
2012 chevrolet malibu. Consumer writes in regards to multiple safety defects with vehicle. *ldthe consumer stated the vehicle has several safety defects including the electric stability control, brakes, sensor lights, steering, suspension, wheels, engine lights, power train. Updated 10/23/2017
Loss of power steering while driving on city streets. Power steering works for about 5 minutes then it goes out and i get3 messages on dash back to back powering steering / service esc/ no esc. Power steering does not work at any time during the trip. When car is turned off cycle repeats.
164,00 miles.temp 34 f.drove car 3 miles and stopped at intersection.put signal on and attempted left turn. Steering became locked.break and accelerator went to lowest position nearest floor. Engine stayed on but car would not move even after lifted foot off break and attempted to push accelerator. .put in park.stopped engine.restarted. No change after start.again put in park pushed on break turned ignition it started.was able to drive and steering back to normal. No noticeable problem after that.
The contact owns a 2012 chevrolet malibu. While driving at any speed, the steering wheel shook and the power steering failed. In addition, the "esc" indicator illuminated. The dealer was not notified, but the manufacturer was made aware of the failure. The approximate failure mileage was 175,000.
My power steering goes out randomly. I can be parked it goes out, i can have my foot on the brakibg while in drive , it goes out. I can be driving anywhere and it goes out. The air bag light comes on randomly. And then my esc warning light comes on as well. In all of these instances it's all random when it happens.on 10/13/2018 m y power steering went out that is the most recent incident.
The contact owns a 2012 chevrolet malibu. After the vehicle was serviced under nhtsa campaign numbers: 14v252000 (electrical system, electronic stability control, exterior lighting, service brakes, hydraulic, vehicle speed control) and 15v269000 (seat belt), the steering wheel ceased without warning. The vehicle was taken to an independent mechanic where it was diagnosed that the cause of the failure was undetermined. The vehicle was not repaired. The manufacturer was not notified of the failure. The approximate failure mileage was 137,000.
Started out when i'm just driving down the road my steering wheel twitches.now has gone to esc power steering warning indicated and the steering wheel completely locks up.most of the time just when i start the car however has done it when i'm driving down the road.thankfully it was a secluded road and i didn't hit anyone.this is super dangerous and according to my search of the internet i'm not alone.
Takata recall for a chevrolet chevy malibu 2012, you cant tell how fast your going the head light electrical fuse needs replacement, driver pedals need to be replaced also.
The contact owns a 2012 chevrolet malibu. While driving 10 to 15 mph, the vehicle lost steering power. As a result, the vehicle veered left and crashed into a ditch. The vehicle was towed out of the ditch. The contact stated that a warning indicator illuminated only during the failure. After the crash, the steering column shook violently. The dealer diagnosed that the power steering module and the power torque module needed to be replaced. The vehicle was not repaired. There were no injuries and a police report was not filed. The manufacturer was notified. The failure mileage was 163,000.
Steering malfunction. Steering clicks and jerks while driving, stopped, and in park. Steering fails while driving. Turning car off and back on sometimes releases steering how many complaints does it take?there are past recalls for the same exact issue!! not safe!
My power steering went out as i was exiting the highway at a bend and while i was turning to begin driving on the city streets. I had my 2 month old daughter and 6 year old son with me at the time this happened which frightened me tremendously.
The contact owns a 2012 chevrolet malibu. While driving 60 mph, the vehicle experienced a loss of power steering. The vehicle was difficult to maneuver and a loud noise was heard coming from the front driver side wheel. The traction warning indicator illuminated. After several minutes, the vehicle was able to operate normally, but was vibrating. The vehicle was not diagnosed or repaired. The manufacturer was not made aware of the failure. The failure mileage was approximately 100,000.
We own a 2012 chevrolet malibu that has a problem with excessive vibration (shuddering) in the steering of the car especially when turning a corner.but now the car is developing more abnormal issues like the steering wheeling is moving back and forth on its own while driving on a flat straight smooth road.also noted are clicking noises now heard in the steering wheel hub.with the worsening condition of the steering i am becoming reluctant to drive the car because i am concerned about the steering failing while operating the car.i have notified chevrolet and i am waiting for them to get back to me.the car has been in the chevrolet service dept. At least 6 times since 9/05/2013 for this problem and with 3 of those times was with a chevrolet engineer.but chevrolet cannot fix the problem and it is getting worse.
While driving the power steering would turn off and it is very difficult to drive (steer). The problem is that it has electronic steering control module which warms up and cuts out the power steering. It will display "power steering service esc" and symbol comes on. This is an unexpected ongoing problem like in the morning it will be o.k. But late in the afternoon it could happen while driving.
The contact owns a 2012 chevrolet malibu. While driving approximately 35 mph, the vehicle and steering wheel vibrated violently. In addition, when making a left turn, the steering wheel became difficult to maneuver and seized. The vehicle was taken to a dealer where it was diagnosed that the steering rack and pinion failed and needed to be replaced. The vehicle was not repaired. The vin was not included in nhtsa campaign number: 14e044000 (steering). The manufacturer was made aware of the failure. The approximate failure mileage was 55,000.
Takata recall: i'm having the same issue that's attached to gm recall 13036. I just took it to the chevy dealer and this recall wasn't attached to my vin, even though my car was manufactured in the same year listed in the 13036 recall. My vehicle is dangerous to drive ! the esc light flashed 'off' then it says service esc . The check engines illuminates and flashes as well as the service traction . I've replaced spark plugs , injectors and wiring attached to the cylinders, to fix the codes being shot out (p0302 / p0352) and the problem continues . The steering is rough and makes noise while turning , especially when vehicle is cold . The sound is really loud . My vehicle has stalled a few times has i came to a stop at stop signs and intersections . This needs to be fixed asap !!
Esc light went on.suggest was to get esc serviced because of power steering failure.when engine ws turned off and turned back on, everything worked.but the same thing continued to happen time and time again.went on the internet and noticed that a number of complaints have been filed similar to what i am experiencing.this happened at slow speed, higher speeds and when stopped.car was drivable without power steering but difficult to maneuver.
Power steering keeps turning off while driving and i get this 'warning' come on, service esc power steering. Really scary driving on freeway and power steering suddenly turning off. What is the solution? is there a recall?
07/2013 service esc msg and symbol came on , dealer unable to find01/07/2014 same01/15/2014 again, gm paid half of the repair, because the first time it happen and was notice by dealer, i believe gm should paid the whole cost, as this is a safety issue , effects steering and stabilization of the vehicle.
2012 chevy malibu recently turned 98,000 miles. I was trying to make a turn after stopping for a stop sign and the power steering service, esc light comes on. The steering wheel became stiff and very hard to turn. Was able to get car to the side of the road, turned engine off and on and i was able to drive. Very scary, i have read that this happens a lot with these cars. How can there not be a recall???
Takata recall powersteering went our while driving.
The contact owns a 2012 chevrolet malibu. The contact stated that while making a right turn at approximately 5 mph, the steering wheel became difficult to maneuver as the esc warning light illuminated. The vehicle was not diagnosed or repaired. The manufacturer was not notified of the failure. The failure mileage was 98,000.
While sitting still the wheel moves by itself. Then when driving the power steering goes completely out. Making it hard to move off the road. Then u have tko shut it off and restart and pray u make it home safely. This was a car bought for my teenage daughter and now i'm scared for her to drive it. Needs to be recalled before someone gets killed
Power steering light comes on and my steering wheel is twitching and jerking.
I have only had my car in my care for going on 3 years. The steering wheel pops when making a right or left turn. After about 6 turns the steering wheel fails to turn and gets stuck. I had a mechanic look at it and he said it is the rack and pinion. Agter getting an opinion i have other people i know saying that there was a failure in the rack and pinion in this make and model of vehicle yet no one has issued a recall for my particular vin number/vehicle make and model.
The contact owned a 2012 chevrolet malibu. The contact stated that while making a left turn, another vehicle crashed into the rear passenger side of the contact's vehicle. The contact stated that the steering wheel and steering column detached from the vehicle, which landed on the contact's lap. The air bags failed to deploy. The contact was concerned that if the steering air bag deployed, he would have sustained possible fatal injuries. A police report was filed. The front passenger sustained back bruises that required medical attention. The vehicle was towed to an impound lot. The vehicle was destroyed. The manufacturer was notified of the failure. The failure mileage was 33,000.
Same power steering problem. The electric power steering goes out sometimes midturn. Im an adult male and ive hit the curb a couple times if this happened to a female or child it could cause a serious accident. Im scarred to drive it. G.m. Needs to stop selling these electric power steering units. Mine is 2012 malibu just turned 100000. The esc light comes on and says power steering on dash.
The steering wheel is very difficult to turn requiring vehicle to be restarted frequently.
I have been having problems with my steering nearly everytime i would start my car. After starting it repeatedly it usual would steer but today as i was driving the steering froze! it was very scary and could have turned out dangerously. I am not sure what the problem is but i see that many others are having the same problem with the steering of this year and model/.
"service esc" light illuminates when making sharp turns, slowing down on the interstate, as well as breaking in bad weather. After replacing brakes twice and rotors once i scontinue to experience this problem . After a recent inquiry i learned of a recall on "service esc" as well as "traction control".
The contact owns a 2012 chevrolet malibu. While driving 70 mph, the power steering ecs activated warning indicator illuminated and the steering wheel became difficult to turn. The contact associated the failure with nhtsa campaign number: 14e044000 (steering). The contact called victorville chevrolet (located at 15425 dos palmas rd, victorville, ca 92392, (760) 475-9098) and informed them of the failure. The vehicle was not diagnosed or repaired. The manufacturer was not notified of the failure. The failure mileage was 204,000.
Driving and car had severe electrical problem that caused the car to randomly stall while driving. We lost power steering and power brakes. The instrument panel starting going crazy displaying all lights, saying device esc and the doors locked and unlocked. The engine stalled and transmission started jolting around. The car would not turn back on after turning it off. Took the car to starling chevrolet to get it fixed the following monday since closed sunday. Before taking to the dealer took the car to auto zone to check the battery. Autozone stating battery was great. Chevrolet didn't look at the car at all monday, and tuesday stated we need new battery. I advised of auto zone reading and was told autzone was wrong. Picked up the car tuesday after having a brand new battery put in for $270. Today is the following friday and the car did everything again while driving and will not start. Now i have to tow the car to chevy again.
All lights on the dash board had brake pads installed vehicle making noise while driving vehicle pulling to the right, had three sensors replaced dash board light still on05
Loss of steering when turning. Driver info panel saying escand service power steering. !
My power steering is not working properly. I have to turn the car on and off for the power steering to work. The steering wheel shakes and the esc is on.
The steering wheel tends to shake and turn left or right while you're driving almost caused a wreck idling it shakes really bad
For about the last two weeks when i turn my car on a esc power steering message has illuminated the dash. I have to turn my car off and back on several times to get the message to disappear. Tonight while driving the same message came on. I ended up having to pull over several times during my drive each time losing power steering! very scary and very unsafe. When i search my vin number there are no recalls on it, i feel there needs to be before someone is hurt or killed in a accident.
My 2012 malibu 1lt has some of the same issues the recalls are for but my specific vin number isn't included in the recalls. My driver seat moves when sitting in it and i need a rack-and-pinion. I'm also having issues with a 'rough' idle and when i put it in park the rpm's die down between 1&0 and the car acts like it's trying to cut off.
I purchased the car in march 2013.it only had 18,000 miles on it.while slowing, such as exiting the interstate, as the car down shifts, it down shifts hard.especially going from 3rd gear to 2nd and then 1st.it seems to have a slight delay when trying to pick up speed.more so when you have slowed and then sped back up, like when someone is turning and you have to slow for them.there is an awful noise in the dash around the steering column.if you are on a gravel road, it sounds like the dash/steering column is going to fall onto your feet. Its a rattle type sound.
The intermediate steering shaft and motor failed.i was almost killed.they said it is not covered under any recall or extended warranty.the part number is 20821325.i will never buy another malibu. Nothing but problems on the 2012
Esc light came on,lost power steering while maneuvering on extremely icy curve on freeway. Fortunately was able muscle the car to side of the road without accident. Found hundredsof complainants on nhtsa web site for this exact same issue, but couldn't find where there was any recall for this issue per my cars vin number. Extremely dangerous problem that manufacturer needs to address.
I was driving 55 mph on highway and power steering went out steering wheel stiffing up and i almost went in the lane next to me./ second time i just made it to work tr=urn the steering wheel to park and it went out again./rear defrost don't work changed fuse and still wont work
The contact owns a 2012 chevrolet malibu. While driving 65 mph, the steering wheel seized. The brake pedal was depressed, but the vehicle failed to stop. As a result, the contact lost control of the vehicle and crashed into a guardrail. The air bags deployed. The driver sustained minor cuts, bruises, and wrist injuries that required medical attention. A police report was filed. The vehicle was not diagnosed or repaired. The manufacturer was not notified of the failure. The failure mileage was 52,979.
My power steering light comes on and i am not able to turn my steering wheel. This has happened several times in the last week while my car was stationary. Also while i was driving tonight the car made a sound warning and right after that my power steering locked up while my car was in motion driving on a city street. I had to put my car in neutral turn my ignition off and then back on to get the steering back in my control. I believe this has something to do with the power steering. My steering wheel shakes ever since i first noticed this issue and the steering on this vehicle sometimes just all of a sudden pulls off to the left or to the right for no reason. My tires have the proper inflation and are only 3 months old. I drive down a mountain with lots of curves in the road to get to and from work if the steering decides to lock up while i am driving on a curve this could cause a very bad and possibly fatal accident. This car does not have a place to add power steering fluid the manual states to bring the vehicle to the dealership if this keeps occurring.
I was driving my children to school, when without any warning my power steering went out. I almost got into an accident!!! it was very abrupt. A message saying "power steering" "service esc" came up. I come to find out that earlier models of the malibu were recalled for this very reason. I would recommend that you check this problem out very seriously on the 2012 model before someone gets killed!!! i had all i could do to steer the car manually! my children and i were very lucky that we didn't end up in an accident. The next person might not be so lucky. Before chevrolet gets sued, they might want to look into this problem. My wife drives this car on the expressway. I can't even imagine what would have happened had this occurred while she was driving. I thank god that i was behind the wheel at the time.
The contact owns a 2012 chevrolet malibu. The contact stated that the steering wheel abruptly locked while attempting to turn at a low speed. The failure was experienced several times. While the bluetooth was in use, the radio and steering wheel simultaneously failed. The vehicle was taken to the dealer where it was diagnosed that the battery cable was defective and caused the electrical system to lose charge. The vehicle was repaired. The battery cables were replaced and routed correctly. The manufacturer stated that the cable failure was due to wear and tear. The failure mileage was 47,607.updated 09/20/16*lj*as
Pulling out of a parking space, all of a sudden my steering wheel does a quick jerk, my traction light luminates and then service esc comes up on the display and then power steering shows on the display and at that point iost power steering assist and at this point i could not turn the wheel at all, i had no control over the car at this point.i put the car in park, turned it off for several minutes and then turned it back on and power steering was back.this is unexceptable...what if i had been on the free way going 70 miles per hour and lost power steering.this very issue was a recall on the recalling certain model year 2004-2006 and 2008-2009 chevrolet malibu(s) and obviously it is still an issue with the 2012 model.i have had no issues with steering prior to ths day it happened 10/30/16 and no warring power steering assist was going to fail.fix it once and for all gm. Do your customers have to be seriously injured or worse in order for you to get this right!!!!now we have to find the power steering unit and get it fixed because my car is literally a death trap.also, the interior lights (dome) and headlights start flickering after 10 mins to 60 mins into my drive like there is an electrical issue. Also, the rear defrost stopped working and i can't see out the rear window, i have to drive with the windows down to try and hurry the process along and that is not fun when it is freezing out side!
The valet parking attendant brought the car back to me and stated the power steering was no longer working on the vehicle, but he knows it was working fine when he parked it. Drove vehicle home with extremely difficult steering; restarted vehicle and power steering worked for 10 minutes and went out again all while staying in my driveway. Now scared to drive unit.
The contact owns a 2012 chevrolet malibu. When the vehicle was started, the steering wheel became very difficult to turn. The contact stated that the vehicle experienced the same failure for eight months, but had gotten worse. The vehicle was driven to the dealer (montgomery chevrolet in louisville, kentucky) where it was diagnosed that the rack and pinion and steering shaft needed to be replaced. The manufacturer was not notified of the failure. The vehicle was not repaired. The approximate failure mileage was 110,000.
'takata recall ' i was driving down the road at 35mph and all of a sudden my service esc light came on , my traction light came on, the power steering light came on and i lost steering capability of the vehicle and almost caused me to wreck . It made it nearly impossible to try to turn to even get my car off the road .
Purchased car from ed bozarth on october 12.within 1 week the brakes were grinding and you had to step on it hard for it to brake.have changed brake pads and rotors twice within 3 years.have complained to ed bozarth since i purchased it.i have taken the car to other gm dealerships and complained about the brakes.september 2015 took it to fletcher jones chevrolet and had filed a complain with gm for approval to have them pay for the diagnostics.and again, the dealership and gm claim nothing is wrong with the brakes, but they grind horribly and you have to hit hard on the brakes to be able to brake.another issue is the rubber steering wheel.it is coming apart and it cuts you as you are making right turn.being diabetic it is a health issue.
Vehicle (2012 malibu) was purchased april 2012 - starting july 2012 vehicle would stall going down the road, with loss of engine, power assist steering and power assist brakes. Dealer replaced numerous modules, but it occurred again in sept 2012 (3 times) then again in january 2013. Two body control modules have been replaced, engine control modules, two power steering modules, onstar module, transmission control module, etc. Unintended power steering assist occurs such that within approximately 5 seconds while driving down the road, power steering comes in and out as module fails (along with engine and transmission). Very unsafe to drive. Dealer would not replace vehicle and gm states they stand by last repair. It has been repaired 6 times now, but we refuse to drive vehicle, as we believe there must be a short somewhere. They keep stating it is defective modules and they just keep replacing them. Please see youtube videos: "2012 chevy malibu - unintended power steering assist failure mode?""2012 chevy malibu dangerous electrical problem - any ideas?"
Esc cut out while driving on a three lane hwy at approx. 45mph
The contact owns a 2012 chevrolet malibu. The contact stated that the front end of the vehicle started to wobble at 55 mph and above. The contact also stated that the dealer did an alignment four times and replaced the steering column once but the failure recurred. The rear right wheel had been leaning outward from the time the vehicle was purchased and had not been corrected by the alignment. The failure mileage was 11 and the current mileage was 19,500.the consumer stated from the day she purchased the vehicle, the steering was difficult to control. As time went on, the problem became worse. The vehicle was wobbly, choppy and careening . It was difficult to control on uneven pavement roads and streets and extremely difficult to maintain at 55 mph and higher. Each time the consumer went to the dealer, the vehicle was out of alignment. At times, the steering was very loose. Also, the shifting was erratic and lagged. It lagged from stop signs. It often failed to down shift to gain power needed on highway upgrades. When the consumer attempted to pass semi-trucks on an uneven pavement on the interstate, the vehicle pulled to the right, jerked to the left with almost an uncontrollable shifting and swaying. If there were curve , the vehicle would dangerously swing wide out into the curves. The steering wheel, would then freeze up and would become difficult to turn and steer safely. On one occasion, while driving on the interstate highway, the consumer had just passed a semi at a speed of 70 mph and as she was returning to the right lane, the vehicle stuttered and started to stop. She pushed the accelerator pedal to the floor and there was a dangerous lag before enough power came to the vehicle.
As time is going on the steering is getting less controllable. I have yet to get into an accident but i can feel the car swerving a bit when i'm steering (swerving i didn't do). I looked up my vin on iseecars.com to see if there was a recall at all with the steering and there was in 2014 . I bought this car last year so i am the owner and am not sure how to go about this. I got it checked out and the mechanic said there is definitely an issue with the rack and pinion and shaft . Also my passenger seatbelt light remains on at all times and there have been minor issues with them.
Was actually driving down the street around the corner from the place i reside and all of a sudden the wheel started to jerk violently which caused us to drive into a curb , causing the vehicle to drive up onto a curb flattening both sides of the right side of the car as well almost clipping a car at the light to our left...the kids on back seat were completely terrified because they had no idea what was going on and are still scared to get into a vehicle...as well have a pplice report could probably obtain if need be.. We just want car foxed right way not trying to sue anybody or get aome outrageous settlement ....
My car is not working the steering wheel and brake
While driving power steering stopped working and esc light came on. Turned car off and is working again. Steering pulls and i'm uncomfortable driving. Recalls were made to year and model of my car but my vin doesn't match up to recall.
My 2012 chevy malibu 4 cylinder power steering keeps going in and out. The service esc warning comes on the traction light comes on. I restart car and it goes away but comes back later.does this whole driving. Can cause accident.
The contact owns a 2012 chevrolet malibu. While at a stop light, the steering wheel shook violently. The dealer stated that the extended warranty had expired. The vehicle was not repaired. The manufacturer was notified of the failure. The approximate failure mileage was 168,195.
The steering wheel is hard to turn and it's getting worse and worse when it is unlocked the wheel shakes like crazy and it has no grip when u turn in the car it is unlocked but as u driving it it locks it's selfnl. At a intersection as i was at a a complete stop once i took my foot off the breaker the steering wheel almost hit the the car in the next lane
Power steering goes out low trac light comes on service light comes on while car was in motion
The contact owns a 2012 chevrolet malibu. While attempting to accelerate from a stop, the steering wheel seized and the power steering assist light illuminated. The contact coasted to the side of the road, waited a few minutes, and resumed driving. In addition, while driving 5 mph in the driveway, the failure recurred. The vehicle was not diagnosed nor repaired. The manufacturer was notified of the failure. The failure mileage was 164,000.
Power steering went out driver the 2012 malibu on the street.locked up and almost was involved in an accident due to faulty power steering.
The contact owns a 2012 chevrolet malibu. While operating the vehicle, the power steering suddenly malfunctioned and the steering wheel became very difficult to turn in either direction. Also, the message "power steering assist failure" was displayed. The vehicle was not diagnosed or repaired. The manufacturer and local dealer were not notified of the failure. The failure mileage was 90,000.
Received letters from gm that this car and two other family owned malibu's (2009 & 2012 model years) may experience loss of their electric power steering (eps) due to a malfunction in the steering column torque sensor or the eps motor/controller. These vehicles were not part of the earlier recall nhtsa campaign # 14v252000 ( electrical system problem) which couldaffect steering and several other systems. My complaint is how can this company who covered up the ignition problem which killed over 100 people be allowed not to issue a recall for this problem. I have read horror stories on the nhtsa and arfc.org. Web sites of people who also were not part of the earlier recall crashing when their power steering failed. Do i have to wait until my wife or my two daughters get killed, as well as my grandson before my cars are fixed. This leads me to question why has the nhtsa not gone after gm for this when it is just as dangerous for this possible malfunction to occur as it did with the electrical system problem? also the nhtsa needs to find out if there are replacement parts that do not have this problem or else changing them will serve no purpose other than giving the dealerships money to do useless diagnostic tests which run over $100 each which gm told me i have to pay for. This letter was sent to owners for model years 2007 to 2012 for which the 3 year warranty has expired, promising free repair for 10 years from the date of purchase "if" you have trouble with your eps. The letter stated not to bring the car to the dealer unless you are experiencing a problem? so if you have trouble and get killed in a crash they will fix your car. I wonder if any letters were sent to owners of newer vehicles if the same defects are still in their cars? i have contacted my local paper and the ftc on this matter and i urge everyone who gets this outrageous letter to do the same.
Left store and care was driving fine, lost power steering and esc light came on. Was able to pull over. Cut car off and turned back on and issue was fixed. As soon i as pulled in my garage, i lost power steering again. It's dangerous especially when you are driving down the road in traffic.
The electronic power steering failed while driving. Service esc light came on and car was nearly impossible to steer. After turning off the engine and restarting the car, the power steering came back on. Now it is going in and out. Sometimes i can steer and sometimes it is almost impossible.
The contact owns a 2012 chevrolet malibu. The contact stated that the driver was driving 10 mph whena clicking sound emitted from under the hood and the power steering failed. The vehicle was towed to the dealer. The manufacturer was not contacted. The vehicle was not repaired. The vin was unknown. The failure mileage was 500 and the current mileage was 550.
"power steering" message comes on randomly and the power steering goes dead while i'm driving. This seems to be a known issue with this malibu and should be a recall. There are many complaints online about this issue. This has occurredmultiple times. This is dangerous and should be a recall purchased vehicle in 2013 since than has happen close to 10 times.
While driving to school going roughly from idle to 10mph as started to get on the highway the esc services power steering light came on and i lost all power steering. Needless to say me being 5'3" and 98 pounds didn't help me much to control the vehicle.i slowly pulled over to the side of the road and gathered myself not knowing what just happened. I turned off the car and gathered my thoughts. Luckily i was on straight away with no turns when this happened.so i preceeded to turn the car on and noticed the message was gone so i checked the steering and the problem light was gone.well with that said, that was the first this had happened. And now it has progressed during the winter. I don't know if the cold has anything to do with it. But this is scary and gm should try to address it. I believe there was a recall for this issue but my vin doesn't show that recall. Can you please help. The problem is starting to happen when i start my car now.
There is a steering recall for my car but not for my specific vin #. I'm having the same issue with mine as well. My racking pinion needs to be replaced.
Well while turning on my street the steering wheel locked up and esc light came on which almost cause me to hit my neighbor fence and car trying to turn..i was very scared had car put in shop and they told me steering was gone out..i didnt no about this recall stuff because i had to pay close to 1000 to get thos repaired..how can i get refunded for something that was a recall on
Steering malfunction while driving. The steering wheel locked making it hard to steer the vehicle. Message for esc and power steering came on. The steering wheel continues to jerk and twitch when driving.
While making left hand turn engine stalled lost power for a moment then restarted several times in the last year.
The steering wheel gets hard i kind think that it's electric steering motor
"power steering" message comes on randomly and the power steering goes dead while i'm driving.this seems to be a known issue with this malibu and should be a recall.there are many complaints online about this issue.this has occurred in april 2020 and multiple times in may 2020.this is dangerous and should be a recall.
When driving, at low speed in the city, or on the highway at speed, power steering and power brakes intermittently fail without warning (according to the repairing dealer, vehicle is unsafe and should not be driven); dash gauges go on and off; traction control and electronic stability control turn ownand off without warning; dash lights go on and off without warning; bells and buzzers ring; door locks cycle, and theft deterrent warnings illuminate. Dealer has attempted multiple times to repair it by replacing the body control module. It is at the dealer service department now, has been there for a full week and at this point is still unsafe
Driving my vehicle with my 3 month old daughter in the car. Turned the wheel as i was taking a turn and the power steering completely stopped. This forced me to apply the brake because i almost wemt off the road!! i see this isn't the only incident involving the esc and power steering!! vehicle currently has "service esc" and "power steering" messages displayed in the info messages.
When idling in park my steering wheel will shake back and forth. And then i keep losing my power steering function. And then i have to restart the car and it will come back on. This has been happening for 2 days. With the esc light in the power steering lights coming on on intermittent.
The contact owns a 2012 chevrolet malibu. While attempting to exit a residential driveway, the power steering failed without warning. The contact mentioned that the wheel locked, which made it extremely difficult to maneuver. The vehicle was taken to the dealer. The technician performed unknown repairs and refused to provide any details. The manufacturer was made aware of the failure. The vehicle was not repaired. The failure mileage was 63,000.updated 2/4/16updated 02/16/16
The contact owns a 2012 chevrolet malibu. After the vehicle was started, the steering became difficult to maneuver. The contact mentioned that the failure only happened initially after driving off. The failure occurred constantly. The vehicle was not diagnosed or repaired. The vin was not included in nhtsa campaign number: 14e044000 (steering). The manufacturer was not notified of the failure. The approximate failure mileage was 43,000.
On 2/5/2020 while driving to work my steering wheel started to twitch while driving . After i arrived to work and put it in park the steering wheel was shaking back and fourth. Now after work i come out it had no power steering esc light on and a message power steering problem. Took vin to dealer no recall for my car. This is a common problem with these gm electric power steering systoms. There are recalls out there for this problem. 2012 malibu included just not mine. Very dangerous
The contact owns a 2012 chevrolet malibu. The contact stated that the steering failed on the vehicle. The failure caused the contact to drive into a snow bank. The contact stated that the power steering light illuminated on the instrument and the traction control light illuminated on the instrument panel. The contact stated that the failure prevented the vehicle from being steered. The contact spoke with the manufacturer and was informed that the electronic steering module was not under recall and that the vehicle was not included in nhtsa campaign number: 14v252000 (electrical system) even though the body control module needed to be replaced. The contact received this information from a senior safety supervisor from gm. The failure occurred four times. The vehicle was not repaired. The vin was not available. The failure mileage was 61,000.
Was driving down a crooked road when steering felt like it locked up. Barely made it to side of road without crashing. Flashed ecs and powersteering on dash. After i restarted the engine it quit but did it again about a week later but the 2nd time it didn't quit after turning the car off, but the next day it waa driving fine again.
Off and on my power steering goes out, i can be at a redlight, parked or even driving and it goes out, i end up having to turn off car if im parked or at redlight, and if im driving i go into neutral to turn car off and then off... My esc goes off als, this has happened several times since i first purchased the car, so since 2012 it most recently happened last night on my way home from work while at a light
The electronic power steering failed while driving. Service esc light came on and car was nearly impossible to steer. After turning off the engine and restarting the car, the power steering came back on. I have looked it up and there is a recall for this problem but my car does not seem to be part of this recall.
Car upon starting would not have power steering .the owners manuel said to turn key off then on ..the power steering would come back on and car would drive fine for a few days then would happen again upon starting with error message esc service ,with a warning bell.. Then while driving one day lost all power steering .and wrecked into something while turning to the right ..damage to front end and grill.no warning and gm doesnt want to help me get rental and transferred my case to higher department who isn't willing to help me .. Was told the rep was to busy to take my call ..lost time at work and in dark of who's to cover the damages from faulty part .. Very dangerous and the people at gm said that if i got the repairs done that it would end my claim and car would not be repaired.
While driving the power steering goes outsays power steering off service escturn car off and restart went away i take it in and no code stored.my wife is affraid to drive the car
The contact's daughter owns a 2012 chevrolet malibu. While driving at an unknown speed, the power steering failed without warning and the vehicle became difficult to maneuver. The vehicle was taken to an unknown chevrolet dealer in kentucky where it was diagnosed that the steering column needed to be replaced. The vehicle was not repaired. The vehicle was not included in nhtsa campaign number: 14e044000 (steering). The failure recurred several times. The manufacturer was notified of the failure. The approximate failure mileage was 119,000.
Power steering, lights, electrical stability, engine, transmission
We purchased a 2012 chevrolet malibu sept. 2014 and it has been serviced 3 x due to the power steering locking up while driving and failure to start several times.the car would chime and the gauges would all drop to 0 and the engine light, power steering, low fuel and anti-theft light would all light up making the vehicle very difficult to maneuver.
At random i will be driving down any road and the power steering, traction control, ecs lights will come on and i will lose power steering. I have to pull over and completely stop and turn off ignition and wait a few minutes and turn back on and the problem is reset. This happens at random with no pattern.
I have an ongoing issue in which the power steering on my 2012 malibu locks up and it's extremely hard to rotate the steering wheel to make turns....it has happened on numerous occasions from being parked from a cold start to recently actively happening while driving on the road/highway. The computer dash display pops up saying power steering then says service esc
Steering wheel sticks on occasion and is hard to move. Sometimes it will jerk side to side in a shaking motion before sticking. My car goes out of lane.
Driving approximately 30 mph down the road my steering stiffened and i heard a chime and service esc across the dash warning system, i could not turn the wheel. The electronic steering control was not working and i had to try to manually steer. I had my 1 yr old and 4 yr old in my vehicle and the roads were snowy and icy, and no way to steer my vehicle safely.
Constantly having issues with the electical system in this vehicle, and from further studies and investication via internet complaints and youtube customers/owners...this is a continual ongoing problem for a substaintial amount of chevy malibu owners from the year of 2009 to 2013/2014 models. There should be a recall asap on these make and models. The issue is that the headlights constanly short out and blow out. Mechanics and service has found that the electtical connectors for hllightbulb overheats, melts the wiring, and burns out bulb> this is very dangerouse and is a fire hazard. This has happened at least three times on my vehicle alone. Also constat problems with rear right wheel convertor speed and tire sensors, and the entire electrical system over all. The wiring in this make and model vehicle constantly have blow out fuses, the emergency light indicators always coming on, and the sensors on and off. This is a well noted and documented occurans with these vehicles. These cars need to be recalled due to danger with possible fire and car stalling out while driving due to electrical issues and heating/cooling ac wires shorting out. In all overview this has caused me severe finacil problems due to constant repairs and part replacement. It is a danger to myself and others on the highways and roads. I need this to be addressed immediately. I have some of the meltedfire sparked parts.please contact me as soon as possible. Many days i dont have needed transportation due to these issues and i get repairs all of the time while still paying a car note. I am scared to keep driving thius car.
On wednesday january 6, 2021, i was on my way home from picking my son up from school when i went to make a left turn from the center divider and my steering wheel would not turn! this caused me to make an emergency stop in the middle of the busy city street and to park up on the curb to avoid ongoing traffic. I tried to turn the wheel manually with a lot of strength but it did not move. Then a warning signal appeared saying (power steering). I turned the car off and back on to see if this helped, it did. After i got home i did not drive the car anymore. I am waiting to see if this repair is covered under chevrolet's warranty regarding eps (electrical power steering) vehicles.
Car would shimmy and shake. New tires new breaks etc. Made appoint. To fix recalls when power ster. Went out. Put new ps on and itdidn't fix problem. Went back and forth to dealer. Had car diagnosed and service manager said there was a recall for so called gm, rep said they would fix and reinburse for the work already performed, gave a case number.car sat a dealers weekend. Today gm rep said they would only pay 5% and denied other rep had said they'd fix. No power steering on car and it's dangerous to drive due to manufacturing defect and i'm expected to cover costs when i've already spent nearly 1000 on it and it's still not fixed. Please help
The contact owns a 2012 chevrolet malibu. While driving various speeds, a noise was heard coming from the steering column. The contact stated that the noise could be heard more while driving over bumps in the road. There were no warning indicators illuminated. The vehicle was taken to gengras chevrolet (585 connecticut blvd, east hartford, ct 06108, (860) 748-4388) where an unknown failure was detected and the contact was informed that the steering column needed replacement. The contact stated that the vehicle was not repaired as he found recalls online for the steering column failure. The manufacturer was not made aware of the failure. The failure mileage was approximately 50,000.
Driving down the city road at 55 mph, i heard three bells and on the dashboard it read "service esc...service esc...traction control off" the vehicle then simultaneously began to reduce engine power and the steering wheel locked and became unlocked within seconds. This caused swerving and a near accident. I see recalls for this issue but the vin does not show an open recall for this issue.
My esc comes on with traction emblem and power steering light. I then lose all power steering while in motion.
The contact owns a 2012 chevrolet malibu. While driving various speeds, the contact heard an abnormal noise. The vehicle was taken to a dealer where it was diagnosed that the power steering fluid was low and needed to be filled. The vehicle was repaired; however, the failure recurred. The vehicle was taken back to the dealer, but the cause of the failure could not be determined. The manufacturer was not notified of the failure. The failure mileage was approximately 24,000.
Several systems have been affected.the systems affected are the radio controls on the steering wheel, the power steering, the traction control and the rear defrost.there seems to be a short that goes from system to system.modern chevrolet in winston salem, nc said it was a short in wires on the steering column that was causing this.there are three recalls that would deal with this.the recalls are for steering, traction control and finally wiring.both modern chevrolet and chevrolet corporate have said my vehicle is not covered due to the vin #.i do not see where that matters.if a part is bad then all vehicles that part is used on should be covered no matter what.the steering was the most affected.the power steering would go out and it was very difficult to steer the car.this happened on several different occasions.
Started my 2012 chevy malibu up and power steering light came on and also service esc. Car had no power steering. This was after the first night of events i was at. So i drove it to the hotel i was at.found out when trying to correct the problem that it has a electronic power steering. Drove it to a dealership but they couldn't service it on the weekend. I was 3 hours from my home at an event. So i drove it back to my hotel with no power steering. So i drove for roughly an hour with lights on and no power steering. Then was about to head to the day two of the event about 5 hours later and everything works again. I don't know what i need to fix on it at all now. My girl friend was driving when the power steering messed up and she never has lost power steering before and she couldn't even turn the wheel. So i had to drive it for her.
I was rear ended and the steering wheel and shaft completely dislodged onto my lap .the air bag did not deploy. I was pushed approximately 150 ft. And there was no way i could have steered if there was another vehicle coming up the highway. If airbag would have deployed there would have been serious injury to myself.
The contact owns a 2012 chevrolet malibu. While driving various speeds and turning the steering wheel, the power steering indicator illuminated and it became very difficult to turn. As a result, the vehicle drove straight. The vehicle was taken to the dealer, but was not diagnosed or repaired. The manufacturer was not notified of the failure. The approximate failure mileage was 120,000.
The contact owns a 2012 chevrolet malibu. While the vehicle was stopped, the steering wheel vibrated and failed to steer. In addition, the power steering warning indicator illuminated. The local dealer and manufacturer were not contacted. The vehicle was not diagnosed or repaired. The failure mileage was 147,000. The vin was invalid.
My headlights keep going out, my car will not align and the electrical plug will not work
I was driving to work one morning going about 30mph and car just lost all power , could not steer the car, pulled off road, waited about 20 minutes and car started back with no problems, then a few days ago went out to start car and would not start, the instrument panel would light up but would not start, had to have in jumped off, took it to auto place to have battery checked, battery was fine, drove it home, drove it the next morning to work with no problems, then that afternoon, would not start again, had to have it jumped off again, took it to auto place again, and battery ok, allternator ok , i have read several reviews on this car and all seem to have the same problems, have not took it to mechanic yet, but afraid to drive it
While stopped at a red light i noticed that the steering wheel would start shaking and turning on its own. Then a few days later my service esc and power steering lights started coming on and i was unable to turn the car left or right.. I would turn the car off for a few then turn it back on and it would unlock. That lasted for a few more days and then the steering wheel started locking up while i was driving. I took the car to the dealer and they said it was my power steering sensor. Its seems to be working fine now however i will never by another chevy maliibu i have had nothing but problems since i purchase this car the first issue was my light constantly kept going out. I was on the highway coming home from anout off town trip and cars were flashing there lights. I pulled over i had no back lights. I took it the dealer they said it was my battery causing my car to short circuit. It cost me $400. Then the same thing happened 20 days later the dealer wanted me to pay to have it looked at again no way. Come to find out it was a #20 fuse over the rear driver side tire wheel that kept blowing. Needles to say i know ride around with a pack of fuses in my car.. The car has 87,858 miles on it
Letter from congresswoman foxx on behalf of constituent re 2012 malibu steering column recall.the consumer was informed, his vin was not included in the recall.
I was heading southbound colerain.. As i was going through a green light this young ladykept on coming at me and i slammed my brakes on and move my steering wheel in a hard wayto avoid her hitting me and also last year slamming my brakes to avoid hitting a car infront of me that there was an accident on 75 south bound in kentucky my steering wheel has some play in it.
Esc light comes on either right as i start the car or once i start driving and i lose power steering having to stop several times to restart my car. I fear driving my kids in my car because if this ongoing issue.
The contact owns a 2012 chevrolet malibu. While driving 50 mph and while accelerating from a stop position, the steering wheel seized and an abnormal noise was heard. The steering wheel became difficult to maneuver. There were no warning indicators illuminated. The contact called the dealer (motor city buick gmc, 3101 pacheco rd, bakersfield, ca 93313, (855) 393-2841) and was informed that there were no recalls pertaining to the steering failure. The contact was advised to schedule a diagnostic appointment. The vehicle was not taken to the dealer or independent mechanic for diagnostic testing or repairs. The manufacturer was not made aware of the failure. The failure mileage was 88,000.
"takata recall" steering wheel moving on its on lost of power steering olin and out and traction warning on and off. Steering wheel pulsating and turning on its own while stationary.
Vehicle has random loss of electronic steering assist, which leaves no power steering. Also service abs, esc and traction warning lights, eps causes vehicles steering wheel to shake without vehicle being in motion.gm recalled thousands of malibu's in feb. Of 2015 for eps issues but my year is not included. Coincidence? highly doubtful. Vehicle it's scheduled for diagnosis on wednesday. Car was repaired for an earlier recall concerning brake systems.
The contact owns a 2012 chevrolet malibu. While driving approximately 10 mph, the steering failed without warning. The vehicle was taken to an independent mechanic where it was not diagnosed or repaired. The contact stated that the failure occurred several times. A local dealer was not contacted. The manufacturer was not made aware of the failure. The approximate failure mileage was 57,600. The vin was not available.
Power steering cut out while driving on a rural road.was going around 30mph.
I was driving to pull out of grocery store and all of a sudden lost my power steering. It goes in and out of working and steeringis very difficult.
As i was driving my car i heard a pop in my steering wheel and felt it in the gas pedal, and it keeps popping. My steering wheel should not go out! as i was making a left turn it locked up on me and just keeps popping.
I just receiveda letter from gm, informing me of another defect built into my vehicle , only one of which was to recall this vehicle to make a repair, the others, as with this letter has been to warn me of a defect, this letter containsthe vin number of my vehicle, explains what the defect is,however,even though it clearly states that gm is well aware of this defect, because in bold underlined type it states "do not take this vehicle to your chevrolet dealer as a result of this letter unless you believe that your vehicle has the condition as described above".this is very disturbing to me because long before the ignition switch on the chevrolet cobalt model caused the deaths that forced nhtsa to force gm to recall that vehicle to make the necessary repair, i had the ignition switch problem a cobalt i owned and when told it would cost me over $400.00 to have that ignition switch replaced, i created such a commotion in that dealership, that they replaced that ignition switch w/o cost to me, which proves that they were well of off that deadly defect before it caused those deaths, so the fact that this letter clearly states the vin number of this vehicle, as did they of the deadly ignition switch, 'so my plea to you is to force gm to recall this vehicle to make the necessary repairs mentioned in all four of the letters they have sent to me. Because the only way i would know whether or not my vehicle has this deadly defect, is to experience the death that could result from that defect..
Takata recall. My vehicle have had this system pop on a few times. As of september the light has been on abd and has not gone off. It also affect the esc system.
I started my car and the power steering failure message came across the screen, then the esc and traction logos popped up. I shut the car off and restarted it again and it went away.. It did this again while i was driving on the highway and i almost got into an accident with my young kids in the car.. I have seen multiple other people with the same error. This needs to be a recall!
The contact owns a 2012 chevrolet malibu. The contact stated while driving approximately 40 mph, the vehicle wandered out of lane independently. The failure recurred whenever the vehicle was being driven. The vehicle was taken to an authorized dealer, who noticed that both front inner tie rods were protruded outward which caused damage to both front tires. The vehicle was repaired. The manufacturer was not notified of the problem. The approximate failure mileage was 16,000.
Not a safety issue. I'm trying to find out where to file complaints about manufacturing issues to start a recall.my malibu didn't start one after work towed it to mechanic. He said it didn't have oil pressure. He opened up the engine and found pieces of o rings/rtv sealant blocking flow and busted rods, lifters, and loose bearings obviously. I have never had any one open that engine.i feel this is a manufacturing defect. Car only has 90,000 miles. A/c compressor went out at 40,000 miles, rear defrost out rear fuse box corroded and burned wires had to be replaced, wheel bearings out in the front at 50,000 miles. This shouldn't happen with a newer car.dealer no help out of warranty.
Driving on the [xxx] . A large piece of debris from a suspected truck flew and damaged my vehicle. The truck did not stop so i'm not sure if it actually came from it. The insurance company denied the claim because the debris would be considered collision not comprehension (i am covered for comprehension). Now i am stuck with fees that i am not even liable for.
My car was involved in an accident where my friend applied the brakes and was forced into hydroplaning into a barrier, another vehicle and a person. My airbags did not deploy as the sensor was not hit nor did the onstar become alerted that the vehicle had been in an accident. After fighting with insurance companies, my car was totaled then declared not totaled, and repaired. I received the notice of a recall much later after the car was in the accident.
Takata recall it constantly shakes and my car is constantly pulling and random codes pop up all the time .not to mention it's a 2012 and it's rusting majorly. I am driving when my car seems to be missing a beat it wants to jerk on me like it wants to stop running. I was on a city street it happens a lot .
The contact owns a 2012 chevrolet malibu. The contact stated that the driver's seat metal frame fractured, causing the seat to collapse while driving. The contact was concerned that the failure was due to a manufacturer's defect. The dealer was not called. The manufacturer was made aware of the failure. The vehicle was not repaired. The failure mileage was approximately 73,000. *lnthe consumer provided photos.
Passenger door won't open.door lock goes up und down manually and with power lock button or fob, door won't open. Many reports online of this issue.definite safety issue in the event of an accident.
The contact owns a 2012 chevrolet malibu. The contact stated that the windows and the dashboard became frozen on the inside of the vehicle.the dealer stated the contact allowed excessive water moisture to get into the vehicle which caused the windows and dashboard to freeze. The vehicle was not repaired. The manufacturer was made aware of the failure. The failure mileage was 7,176. The current mileage was 25,000.
The passenger door of my vehicle will not open. The automatic lock appears to be working but i cannot open the door. This also happened to the drivers side door a few times but thankfully i was able to use the actual key from the outside to open it. I have read reviews where this is common in this vehicle. This is an extreme safety hazard and i cannot even get the door fixed because it won't open. Please consider making this a manufacfurer recall.
I was in a traffic accident and was bit on the driver side.the impact pushed in the doors and the side curtain airbags did not deploy.i was traveling approx 30 mph and the car ran a stop sign on a city street.
The vehicle was being driven at the speed limit when the tire popped. The impact was as much as a front end collision; the windshield cracked along with the passenger side of the bumper and the wheel was bent. A mechanic said that because the seat belts locked the impact was great enough where the airbags should have gone off, but they did not.
The contact owns a 2012 chevrolet malibu. While driving at approximately 40 mph, another vehicle crashed into the front of the contact's vehicle. As a result, the air bags failed and the seat belts did not restrain the front driver and the front passenger. The contact and passenger sustained minor injuries, which required medical attention. A police report was filed. The vehicle was towed to an independent mechanic for diagnostic testing. The vehicle was not repaired. The manufacturer was not notified of the failure. The vin was unavailable. The approximate failure mileage was 55,000.
Drivers door will not open from either inside or outside of vehicle
Parked in an intersection old hwy us 301 ocala floridawheels turned left which was dark and poorly lit by the city. No orange lights onto a major thin 2 lane intersection. The vehicle was braked during the left turn south position. The front hood in the middle of north bound lane front bumper and plate were in the highway dividing line. Up to the rear driverside passenger doorat the joint of the side street and highway outside line.a bicyclist struck the vehicle his light was thrown into the intersection. He is bleeding hes on the ground. Another female is helping him. The mirror of the vehicle driverside torn off and the front winshield shattered above driverside top. Thrown by impact from his bicycleto the malibu his backpack on the ground. Hes ambulatory transported sheriffs responded fhp came out
The contact owns a 2012 chevrolet malibu. The contact stated that the front passenger side door locking mechanism unlocked, but the door itself would not open. The vehicle was not diagnosed nor repaired. The manufacturer was not made aware of the failure. The approximate failure mileage was 3,000.
It seems to happen when it is cold outside, the undercarriage somewhere sounds like it is loose whenever you hit a small hole in the road, go over railroad tracks, really anything.
The contact owns a 2012 chevrolet malibu. The contact stated that while driving 40 mph, she heard a grinding noise. The vehicle was taken to the dealer for inspection and they stated that the axle needed to be replaced. The vehicle was not repaired. The manufacturer was notified. The failure mileage was 6.
Rack and pinion failure causing play in the steering, pull to one side, clunking and rapid shaking of the steering wheel when braking.
Car would shimmy and shake. New tires new breaks etc. Made appoint. To fix recalls when power ster. Went out. Put new ps on and itdidn't fix problem. Went back and forth to dealer. Had car diagnosed and service manager said there was a recall for so called gm, rep said they would fix and reinburse for the work already performed, gave a case number.car sat a dealers weekend. Today gm rep said they would only pay 5% and denied other rep had said they'd fix. No power steering on car and it's dangerous to drive due to manufacturing defect and i'm expected to cover costs when i've already spent nearly 1000 on it and it's still not fixed. Please help
I was sold a car priced at $4,995 but when the initial contract was signed the car representative failed to keep the price the same and without consent overcharged me for the car $10,000 i called back a week later to notify them the car had went out, was in bad condition, wasn't driving, and put me and my family in harms way. Car shutoff twice in motion once while actually driving on the freeway. I asked to have it repaired due to the fact that i was forced into purchasing their warranty that he stated came with the car but put in the contract later that i would pay $1000+ dollars for it when it's an expired warranty from 2017 when the dealer first got the car so it's only a extended warranty and doesn't help with anything. He came once to repair the car by putting some fluid inside to make it run & instead told me he changed the battery which turned out to be false the car kept cutting off and going out i kept seeking help it was david and abn motorswho refused to fix any mechanical issue i was having with the vehicle and in return the car put me and my family in harms way it is a danger to have or drive with my kids cops said so also it cut off on the highway while driving and leaked an extremely large amount of oil while me and my kids were inside the vehicle i was forced to merge over completely to get out the way of traffic as the car just stopped motion. Something under the hood popped and the vehicle was smoky state officials order me and my family out the vehicle in toledo a hour drive away from my home. They stated it was a safety hazard and that i could not enter my vehicle and took it away. I had even sent over a message to the dealer representative i purchased the car from a month earlier stating i was having problems he refused to respond or help he stated that i already signed the contract and i should deal with it myself.
07/2013 service esc msg and symbol came on , dealer unable to find01/07/2014 same01/15/2014 again, gm paid half of the repair, because the first time it happen and was notice by dealer, i believe gm should paid the whole cost, as this is a safety issue , effects steering and stabilization of the vehicle.
While driving on the hwy i experienced my front wheels shaking very bad when i start slowing down
Was actually driving down the street around the corner from the place i reside and all of a sudden the wheel started to jerk violently which caused us to drive into a curb , causing the vehicle to drive up onto a curb flattening both sides of the right side of the car as well almost clipping a car at the light to our left...the kids on back seat were completely terrified because they had no idea what was going on and are still scared to get into a vehicle...as well have a pplice report could probably obtain if need be.. We just want car foxed right way not trying to sue anybody or get aome outrageous settlement ....
2012 chevrolet malibu. Consumer writes in regards to multiple safety defects with vehicle. *ldthe consumer stated the vehicle has several safety defects including the electric stability control, brakes, sensor lights, steering, suspension, wheels, engine lights, power train. Updated 10/23/2017
The contact owns a 2012 chevrolet malibu. The contact stated that all four tires on the vehicle were faulty while still under warranty. The dealer was not notified. The manufacturer was notified. The tires were replaced. The vin was unknown. The tire information was unknown. The approximate failure mileage was 39,987. No further information was available.
I was driving to work and the service traction light control illuminates and then it also read engine power control. The roads were clearand there were no issues with the drive. I was the only person on the highway and no issues. I had to then drive 30-40 miles per hour on the road, even when i drove into town there were cars passing me. Uphill the car went as low as 23 miles per hour. When the car was idle at a stop sign or intersection the car would shake but it stayed on. As i pushed on the gas to speed up the vehicle would jerk.
The contact owns a 2012 chevrolet malibu. While driving various speeds, the electronic stability control and traction control system warning lights illuminated intermittently. The vehicle was not diagnosed nor repaired. The manufacturer was not notified of the failure. The approximate failure mileage was 53,000. The vin was not provided.
The contact owns a 2012 chevrolet malibu. While driving at approximately 45 mph, the service esc and service traction warning indicators illuminated. On one occasion, the vehicle did not shift out of the park position. The vehicle was taken to a dealer, where it was diagnosed that the brake modulator sensor needed to be replaced. The vehicle was repaired, but the failure recurred. The manufacturer was made aware of the failure and stated that the vin was not included in nhtsa campaign number: 14v252000 (electrical system, electronic stability control, exterior lighting, service brakes, hydraulic, vehicle speed control). The failure mileage was approximately 19,000.
When the traction control is engaged when you touch the gas pedal aftera complete stop if there is a light coating of moisture on the road surface the vehicle will slide to the right.this happens all of the time.i have brought this issue to the dealers attention and they made note of it. As a result i turn the traction control off as i am afraid an accident may occur.
The contact owns a 2012 chevrolet malibu. While driving various speeds, the low traction, service esc, and low engine power warning lights illuminated. In addition, the vehicle decelerated independently. The failure recurred six times. The vehicle was taken to a dealer where it was diagnosed that the throttle cover needed to be replaced. The vehicle was not repaired. The manufacturer was not notified of the failure. The approximate failure mileage was 58,000. Updated 05/11/16*lj
The contact owns a 2012 chevrolet malibu. While driving various speeds, the traction control and check engine indicators illuminated on the instrument panel. The failure recurred numerous times. While the vehicle was idling, the esc and traction control were off. The vehicle was taken to a dealer where it was diagnosed that the valve spring failed or fractured and needed to be replaced. The vehicle was not repaired. The manufacturer was notified of the failure. The failure mileage was unknown.
The contact owns a 2012 chevrolet malibu. While driving 40 mph, the vehicle failed to accelerate when the accelerator pedal was depressed. The traction warning light illuminated briefly. In addition, the vehicle stalled without warning and would require multiple attempts to restart. The failure recurred intermittently. The vehicle was taken to the dealer where it was diagnosed, but the cause of the failures was not found. The vehicle was not repaired. The manufacturer was not made aware of the failures. The vin was unknown. The failure mileage was 107,000.
The contact owns a 2012 chevrolet malibu. While driving 60 mph, the vehicle experienced a loss of power steering. The vehicle was difficult to maneuver and a loud noise was heard coming from the front driver side wheel. The traction warning indicator illuminated. After several minutes, the vehicle was able to operate normally, but was vibrating. The vehicle was not diagnosed or repaired. The manufacturer was not made aware of the failure. The failure mileage was approximately 100,000.
The contact owns a 2012 chevrolet malibu. The contact stated that the steering column seized while the vehicle was being driven various speeds. Also, the traction control warning indicator illuminated. The vehicle was able to be operated after being manually restarted. The dealer was not contacted. The manufacturer was contacted regarding the failure, but received no response. The failure mileage was approximately 180,000. The vin was not provided.
Driver side headlight kept going in and out until completely going out and not working. When getting a new bulb put it it did the same thing a week later. The wiring in the headlight is faulty. The same thing goes for the front speakers of the car. The front speakers will come on and off on their own as well.
Service esc traction alerts and engine sounds as thought it will stall - had map sensor replaced, a few months later issue has returned.occurs while driving and when parked.
I have a 2012 chevrolet malibu. My last note was do on 11-03 my carhas not be running sent october it benign cut off on me while i'm driving when it cut oof i try to start it back up in it want stay crank i have to wait for daysbe for it start back up i have spent $500 dollars trying to get it back running but it still not running it's be to the chevy dealers ship it still not running nelson hall chevrolet tell me they can not catch a code they put a used part on my car in charge me for it i'm told me they do not see a problem with it i pick it up it cut off on me trying to make it home so i got another shop to look at it they told me that my fuel pump will need to be change l paid them $175pick it up came home got ready to go to the store it started up i bagged out the yard it cut off in front of a line of cars i had to get help to push it back in the yardevery where i go i can not cut it off because it want start back up for days now it's just sitting in my yardwhile i bombing a ride to work in every where else i want to go don't know one know what the problem is in why it want stay crank
While driving, the sunroof shattered for no apparent reason.the roof was closed at the time, and the headliner was also closed.it made a very loud noise and the vehicle was pulled to the side to ascertain the reason for the noise.it was discovered that the sunroof had completely shattered.there was no bridge overpass, so it is doubted that something was dropped.no physical injury occurred, however, it was a scary incident.we took the vehicle to the chevy dealer, who stated that there was no recall on the glass and that it must have been a rock.the glass & frame were replaced through an insurance claim.
I am continually having problems with the front love beam lights on my car. In particular the driver side headlight low beam. I have changed the light at lease every 3 mos for the past 2years. I just recently changed theds headlight and the harness and it work initially but 24 hours later it was not working again.
Doors keep unlocking and locking on their own. Does it constantly no matter what i do.. The alarm doesnt do anything and the doors just keep unlocking and locking back and forth all day and night even without the keys inside while parked
I was driving my car and car just shut off, no lights were on in vehicle no signs of any issues at all. Vehicle shut off in the middle of the road.
The contact owns a 2012 chevrolet malibu. The contact stated that all four tires on the vehicle were faulty while still under warranty. The dealer was not notified. The manufacturer was notified. The tires were replaced. The vin was unknown. The tire information was unknown. The approximate failure mileage was 39,987. No further information was available.
On april 1,2018 i was driving on a busy road going 45mph when my carsuddenly lost the ability to accelerate. A couple of warning light flashed on the dashboard esc as well as the engine light. The car began to jerk and drive really rough, before the engine power lost flashed on the dash. I turned on my hazard lights and tried to get the car off the road to a safe area. The car could only cruise because i could no longer accelerate. This car just made it to 82000 miles on the dash, i should not be having an issue like this with this car. This is a very dangerous situation as someone could be seriously injured or even worst death. Please please bring awareness to this issue, which a lot of owners of this vehicle is having.
My vehicle has 86,200 miles on it and i have to have both heads rebuilt because of a burnt exhaust valve.i have been told multiple times that this should not be happening at this low mileage on the vehicle.the engine idles really rough when in park or not in drive or motion.when stopped at a stop light, the "service traction, service esc, esc off" comes on.this goes away once you start driving again.
I was driving down a highway with no traffic around and my sunroof shattered
Car will start and then start shaking and making noises then dies off. Break and accelaretor locks after that
Cracked exhaust manifold causes carbon monoxide fumes to enter the passenger compartment causing illness. Symtoms include, dizziness, nausea, headache, watering eyes, runny nose. A definite health risk.
I have an ongoing issue in which the power steering on my 2012 malibu locks up and it's extremely hard to rotate the steering wheel to make turns....it has happened on numerous occasions from being parked from a cold start to recently actively happening while driving on the road/highway. The computer dash display pops up saying power steering then says service esc
Parked in an intersection old hwy us 301 ocala floridawheels turned left which was dark and poorly lit by the city. No orange lights onto a major thin 2 lane intersection. The vehicle was braked during the left turn south position. The front hood in the middle of north bound lane front bumper and plate were in the highway dividing line. Up to the rear driverside passenger doorat the joint of the side street and highway outside line.a bicyclist struck the vehicle his light was thrown into the intersection. He is bleeding hes on the ground. Another female is helping him. The mirror of the vehicle driverside torn off and the front winshield shattered above driverside top. Thrown by impact from his bicycleto the malibu his backpack on the ground. Hes ambulatory transported sheriffs responded fhp came out
The lights randomly come on then the antilock brake system will start to act up when i go to stop as if i was to slide on ice but i'm not i'm on dry pavement. On city street.
P2138 throttle/ pedal position sensor second time same problem the power was reduce when i was driving in the highway.
Vehicle started idling rough but ran good on the interstate or speeds above 40 mph. Checked timing chains. Chains were loose and jumped time.
The check engine light and service traction lights keep coming on while i am driving and come to a completed stop. The dealership techs stated both lights always come on together when it is something with the emission controls. On star diagnosticresults were:through your recent on-demand diagnostic, onstar detected an issuewith your 2012 chevrolet malibu.the code(s) and explanation(s) associated with this issue is/are:p0300the emissions system is not performing as expected. An issue has been detected in the exhaust emissions system which monitors and controls exhaust gases released into the air from the engine. If the vehicle is continually driven with this light on, the emission controls might not work as well, the vehicle fuel economy might not be as good, the engine might not run as smoothly and could lead to future repairs. Based on the results, you should service your chevrolet within 7 days.if you require roadside assistance please contact (866) 415-5838.please bring this email with you when you go for service.last 8 characters of vin: [xxx]i took the car to manassas chevrolet 1st and was told that the they needed to conduct a carbon flush and that coil 1 was bad which cause the lights to come. Paid a tune up. After paying over $600 the lights came back on. I took it back 3 times and was told it needed to burn the carbon off and coil 2 needed to be replaced. I took the car to lindsay chevrolet for a 2nd opinion because both lights came on again. I was told that coil 2 was replaced by the manassas chevy and was bad. I needed a new engine. I then took it to repair shop in gaithersburg and was told coil 2 was bad, bad a spark plug and cyclinder gaskets were bad. I did not need a new engine. The computer is going bad and thus the reason the check engine and service traction light keeps coming on after all of the above repairs were completed.parts of this document have been redacted to protect personally identifiable information pursuant to the freedom of information act (foia), 5 u.s.c. 55
I was driving on i-70 to columbus & my car stalled. Would start up and idle, but service esc & traction control lights came on. As soon as car got warmed up, would stall again.
Timing chain needed to be replaced. Vehicle has 102,000 miles on it
My car has randomly not been starting. One time i go out and it starts and another time i go out and it just cranks but doesn't start. Have tested the obd but no codes come up.
My car will randomly not start with no engine codes. It appears to have problems with the key insert also says anti-theft. Mostly when i am parked
Antitheft system is causing my car not to start. I have contact gm they are not willing to help. I research online line where chevrolet knows about the issue but want customer to fix the problem themselves. I was stranded for 4 hours in the houston heat with my kids. The car will stop in traffic as well
Car randomly not starting had solenoids replaced and fuel pump. It started a few times then wouldn't start acts like it's going to but not getting enough fuel. Had diagnostic reading done when it was doing this the code reading was vehicle submersion. The mechanic asked if it had ever been flooded like in deep water. Never had been but that was the code reading. He redid diagnostics different codes then came up showing other crazy things. None of these were correct. Anyway long story short 3 different garages had no idea what to do. I traded the car for a new one but i believe this should be looked into because alot of people i've talked to with this year make and model car around the same mileage are having this problem my car had 73000 miles. Sometimes it's shutting down while driving. There is something faulty in the computer system that's not showing up until a few years after purchase. I have receipts of repairs and phone numbers to garages.
The key gets stuck in the ignition switch. I could not take the key out one day and left the key in the ignition switch as far as it could turn and locked the car with the spare key. My car battery ended up dying because the key would not come out of the ignition switch. I finally got the key out and got my car started. It is a constant struggle to get the key out of the ignition switch. I can start the car ok it's just when i stop and put the car in park and try to turn the car completely off the key will not turn all the way for me to be able to pull the key out. This car is only 3 years old and too soon for this to be happening.
I received the attached letter from gm.to me this is a serious safety issue.how is this not a recall.or repairable.
Car starts and after 2 seconds turns back off. Car will start again and drive fine for hours and then it will happen again. Problem is intermittent but no one can figure out the problem and diagnostic won't read the problem. No check engine light.
I was driving my car and when i hit a stopped light it suddenly my car turned off and the traction control light, engine light come on.also service traction, service esc, esc off on the headboard. I already fixed the throttle body, map sensor, camshaft position sensor, gas pedal, altenator, and its still doing the same problem. I need help on finding out what the real problem is. I've been having problems with this car for almost a year now.
After coming home from a basketball tournament shut off my car on saturday night on sunday morning when i went to get in my vehicle to drive to work it would not start. Let vehicle sit all day sunday then on monday tried again still would not start and the check engine light comes on. Had a tow truck come to home to pick vehicle up and drive to delership tow truck driver also tried to start car would not start upone vehicle getting to dealership starts right up dealership drove it kept it over night no issues. I picked my vehicle up from dealership last night drove for about 2 hours parked car for the night now this morning it will not start again. Dealership had my vehilce for 2days and could not find a problem but clearly there is some sort of electrical issue or something otherwise i wouldnt keep having this happen. Something about the tow company lifting the vehicle seems to shift something and allows vehicle to work for a couple of days.
Gm tech bulletins say there is a ghost problem with elect. Stability controller.gm mentions there is no recall or known cure for this..components/contacts were cleaned at serv.shopbut " serv. Esc-esc off"keeps appearing in "driver display"when hitting bumps -turning car.. I will mail service sheets. This option was available on 08-09-10 models of malibu but std. Onmy 2012 car.it is worthless when there is thick snow..i will send , by mail, serv. Records on this unsolvable problem...it continues to happen ,at slow speed -not just one time...i believe you can read the g.m.-tsbs, as it was shown to me....
My car is not working the steering wheel and brake
My car won't turn over after i turn it off sometimes. Sometimes it will be most other times it doesn't. The battery is new, spark plugs are new, sensors are new. Starter isn't the problem. Don't know what it could be? it was stationary when this happens, when i try to turn the car back on.
Ecs light flashed before the car lost power and steering
The driver's side door will lock and unlock but not open
Passenger side low beam headlight keep going out i have replaced bulb and socket several times ..it work only for 2 weeks and problem keep coming ..this is fifth time i'm having to fix the issues
I've had read so many vehicles with same issues on all these models i just purchased this car put a high down payment to be getting left everywhere all chevy dealers dont know where to start and over price it all you all should look into it because its something serious . Car wont start after being used a while, you have to mess with cables and wires for it to start mess with fuse boxes and also sometimes it doesnt work.. Do something about it i'm annoyed of this crap
I was trying to remote start my 2012 malibu in the morning but it didn't start. Instead my car was doing a clicking noise and my headlights where blinking. Once that stopped i was able to unlock my car and then my car wouldn't start and the anti theft lock light shows up on my dash board took me about 15 minutes to start my car my check engine goes on and off also. I checked on line and have read that chevrolet owners have been having the same problem. I've done my best to take care of my car and its not an old car with alot of miles on it. I've already had to pay to change a sensor on it and now this before something really bad happens . I'm regretting having my dad cosign for my malibu.
Headlights keep going out after being changed multiple times
Instrument cluster lights turn on and off.
Low beams both headlights repeatedly go out. Heater/air conditioner turns off and on by itself. Motor has been changed and tested. Is there a wiring problem with this vehicle across the board. I read a lot of people with this vehicle have the exact same issues. Heater/air turns off while in park or drive randomly.
Takata recall my vehicle check engine light came on because of a accelerator pedal sensor going out..i was on the street and my car got to jerking and then it says reduce speed every time i accelerate it barley want to drive..
A couple of months ago, i was driving. 10mph or lower and all of a sudden my cars esc turned itself off.i had difficulty steering it and veered off the road. Thankfully i was able to regain control. I reported it to the dealer, and when my car went in for it's 3rd recall in 2 years, they looked at it. They told me they could not get the problem to duplicate. Then today, as i was parking in ny driveway, i started rolling my windows up when i noticed they were particullary slow. I put the car in park,turned my car off, but the key back in and tried to restart it, only to hear clicking and my steering wheel to be completely locked up. Alot of indicators came on, including the cars security indicator. My car is at 66k miles, but we do routine maintenance and it has never been involved in a car accident.
Not a safety issue. I'm trying to find out where to file complaints about manufacturing issues to start a recall.my malibu didn't start one after work towed it to mechanic. He said it didn't have oil pressure. He opened up the engine and found pieces of o rings/rtv sealant blocking flow and busted rods, lifters, and loose bearings obviously. I have never had any one open that engine.i feel this is a manufacturing defect. Car only has 90,000 miles. A/c compressor went out at 40,000 miles, rear defrost out rear fuse box corroded and burned wires had to be replaced, wheel bearings out in the front at 50,000 miles. This shouldn't happen with a newer car.dealer no help out of warranty.
Takata recall for a chevrolet chevy malibu 2012, you cant tell how fast your going the head light electrical fuse needs replacement, driver pedals need to be replaced also.
2012 chevrolet malibu with horrible shifting - 1st to 2nd is a hard shift and 2nd - 3rd isn't a whole lot better. When it down shifts while coming to a stop it again shifts hard and sometimes abruptly. The rpm gauge also flares when shifting down. I have been jutted out into oncoming traffic when it decides to slip shift. I am afraid to drive this car with my family. The worst part is that the dealership cannot find anything "wrong" with it or tell me why it does this because the poor shifting is intermittent, not constant. Not happy!
2012 chevrolet malibu. Consumer wants to be reimbursement for repairs due to recall for vehicle. *ta
Experiencing erratic throttle response time and hard transmission shifts. When the accelerator is pressed you don't know if the response will be immediate or delayed. The inconsistent delays in the throttle response time pose a safety hazard.
Hard to shift out of park and the traction control disable comes on and the brakes lights will quit working and the stability control shuts off while driving down the road. I researched and i see there was a recall for all this. Recall # 14v252000 is all the same symptoms i am experiencing and i called the dealer and they said my vin is not listed. This needs to be taken care of i was almost rear ended twice due to the brake lights not working when it acts up
2012 chevrolet malibu.consumer writes in regards to body control module system/ brake apply sensor recall notice.the consumer stated he waited for the details to restore the safety of the vehicle. However, unable to wait any longer, he was forced to sell the vehicle.
The contact owns a 2012 chevrolet malibu. The contact received a recall notice for nhtsa campaign number:14v252000 ( electrical system , electronic stability control , exterior lighting , service brakes, hydraulic , vehicle speed control) and stated that the part needed was unavailable to perform the repair. The manufacturer was notified of the issue. The contact had not experienced a failure.
I was turning onto the highway and when i pushed the gas pedal there was a significant delay. I always make sure i have plenty of time when pulling onto the street but this could become a major issue while driving. I have a 3 year old son and i do not want to endanger him if there is an issue with my car.
I have to press gas pedal down more then needed as it feels car lacks power. To go up a hill it lags i shouldn't have to press on petal harder to go.
My wife was driving east down hwy-40 toward salina, ks. She had the cruise control set on 60 mph. She began to have a epileptic seizure (she was cleared by her doctor to drive prior to this incident) at that point the car began to slowly drift of to the right side of the road. The car drove over a culver, the rear driver side of the car struck at concrete form and sent the car rolling of into a field the car rolled four times. After the fourth roll the car rolled back on to its wheels and continued to drive due to the cruise control still being engaged and drove 100ft before coming to rest once it struck a concrete fence post. At no time did any of the air bags deploy nor did the cruise control disengage.the vehicle has a crash response system threw on-star, at no time did the crash response activate. This information was provided to me via the saline county sheriffs. My wife only suffered minor cuts and bruises.
Tl- the contact owns a 2012 chevrolet malibu. The contact stated that the air pressure sensor illuminated multiple times intermittently. The authorized dealer reset the code and the failure recurred. The contact had difficulty activating the cruise control and had to make multiple attempts to get it to work. Also, the battery had drained intermittently and the window wipers had to be replaced. The manufacturer was notified of the failure. The approximate failure mileage was 5. Pam
Transmission constantly slips, when trying to accelerate it does not catch up and revs really high. Transmission has locked up once and it has been replaced by the dealership; however that issue still happens on a regular basis. 2012 malibu lt, i would like this issue investigated and gm held responsible for selling me a lemon car with a defective transmission that has not run correctly ever since my purchase in 2011. I have the paper work that shows the replacement of a defective transmission on a new 2012 malibu that i purchased.
I was driving at 60 mph in cruise control on a straight road. An ambulance was heading towards me so i stepped on the brakes to slow down and pull over and the car accelerated very quickly. This was a very dangerous situation because i was moving towards the shoulder of the road because of the oncoming ambulance. I had to turn off cruise control to be able to apply the brakes. The brake lights are also not coming on when i apply the brakes. The problem with the lighting happened previously and was repaired on 04/28/2015. I thought the problem was included in recall #13036 but i was told that it was a problem with the brake switch and was not part of the recall however when i look up the recall numbers on my vehicle this recall number does not show up as still needing to be done. I paid for the repair and i am now having the serious problem of the brake lights not working again plus the even more serious problem of the brakes not working when i am in cruise control. I do not know how to proceed with having this problem corrected. The recall problem has not been repaired correctly or there is another problem that is occurring. I have attached a copy of my receipt of the repair that was done on 04/28/15.
Car was running on freeway and lights started flashing and then car so stalled and car doesnt start anymore
The contact owns a 2012 chevrolet malibu. The contact stated that while driving 65 mph, the vehicle decelerated. The contact mentioned that the engine powering down and the low traction control warning lights illuminated. In addition, the contact mentioned that the headlights would stop working sporadically without warning. The vehicle was taken to an independent mechanic. The technician diagnosed that the throttle body sensor needed to be replaced. The vehicle was repaired but the failure recurred. The manufacturer was not made aware of the failure. The failure mileage was 82,000 and the current mileage was 89,000.
The car had gm service bulletin 13036 (recall campaign 14v252) performed on september 19, 2014 and the car is experiencing the exact same conditions as described in the service bulletin[1] so the "fix" didn't resolve what is now an on going safety issue.it should be noted in the recall "why" section to owners the use of "...over time...".therefore, the issue is known to be time dependent and the fix doesn't appear to fully resolve the issue into the future.1: we are currently seeing the following conditions:- service brake lamps may not illuminate when the service brakes are being applied.- ifcruisecontrolisengaged,additional service brake pedal travel may be required to disengage it.- traction control, electronic stability control, and panic braking assist features, if equipped, may be disabled.- service esc and/or traction control tell-tales may illuminate with this condition.
2012 chevrolet malibu.consumer writes in regards to body control module recall notice.the consumer stated while driving, the airbag deployed and caused him to have an accident. The consumer was injured.the consumer sent in a recall notice along with his complaint.
While driving on the highway i used the cruise control. I stepped on the brake to slow down but the brake would not release. It frightened me, i stepped on the brake harder it still did not release i had to press off the cruise control button on the console. This happens all the time now. It is an inconvenience and scary.
This has happened multiple times while driving down the interstate.the cruise control is being used and when you go to apply the brakes the car does not slow down but revs the motor up and will not let you slow down.it is frightening to have this happen.if you tap the brakes but doesn't always work or hit the cruise off button it will finally stop.this could be putting us in a really bad situation if you cant get it stopped.also the esc light comes on for no reason while driving on dry roads.i called my chevy dealer and was told the recall 13036 was already done in aug 2014 if this is the same issue as recall.if so it did not take care of the problem and needs to be taken care of before it costs someone their life.
The contact owns a 2012 chevrolet malibu. While driving at approximately 25 mph, the accelerator pedal was depressed and traveled to the floorboard and caused the cruise control to malfunction. In addition, the seat belts did not latch and the vehicle crashed into a tree. The air bags failed to deploy. The contact sustained head, back, and legs injuries that required medical attention. A police report was filed. The vehicle was towed to an independent mechanic and repaired. The vehicle was included in a manufacturer recall. The manufacturer was not notified of the failure. The failure mileage was unknown.
The contact owns a 2012 chevrolet malibu. While driving 40 mph, the vehicle failed to accelerate when the accelerator pedal was depressed. The traction warning light illuminated briefly. In addition, the vehicle stalled without warning and would require multiple attempts to restart. The failure recurred intermittently. The vehicle was taken to the dealer where it was diagnosed, but the cause of the failures was not found. The vehicle was not repaired. The manufacturer was not made aware of the failures. The vin was unknown. The failure mileage was 107,000.
This car suddenly lost power as it began to slow down on a busy street, and then would not drive. The car continued to run, but would not go forward, even after gas pedal was pushed to the floor. It, in fact, started coasting backwards when it was on a slight incline. No indicator light came on. It happened suddenly, and without warning. Service dpt. At dealership can find nothing wrong. We feel that this brand new car has a faulty computer system and is very dangerous to drive.the car is running fine at present, but there are no guarantees that this will not happen again. It poses a safety hazard, and neither chevy or gm are willing todo anything about it.my daughter is afraid to drive the car.
While driving home one night last week, going about 60 mph, my engine cut off. I had to steer the car off the road, and started it back up. Drove another half mile or so, and the car did the same thing. This time, the car would start then immediately shut off. Car would not stay cranked for more than 1 second or so. Took car to dealership the next morning, car fixed under power train warranty. The very next , day, engine shut off while at a complete stop at a red light. Car would not start back up, had car towed to dealership. Dealership has had the car for 5 days now, still cannot figure out what the problem is. The car shutting off while driving is not the first time this has happened, every time i have reported to dealership, and they cannot fix my issue. This is a very serious matter, i have involved chevrolet customer care, and would like to hear from a gm corporate representative.
The contact owns a 2012 chevrolet malibu. The contact received a notification for nhtsa campaign number: 14v252000 (electrical system, electronic stability control, exterior lighting, service brakes, hydraulic, vehicle speed control). However, the part needed was not available. The dealer indicated that it would take months before an appointment could be scheduled. The manufacturer was contacted and could not provide an estimated date for when the vehicle would receive the recall repair. The contact did not experience a failure.
Service esc, traction control inactive,loss of power/sluggish when driving or stopped at a light. Code 13036
The esc service light came on, while i was driving then the steering wheel locked up.
Car suddenly failed to accelerate as i pulled on the the interstate. Car filled with a burning smell.dealer said the rear defrost malfunctioned and melted the fuse block located in the trunk damaging all wiring on the fuse block. I'm concerned that this bypassed the fuse and the relay with such a surge that it was hot enough to melt the entire fuse block. This could have led to a very serious fire where i was trapped in the car. I was fortunate to be able to pull off the interstate, but if i were in the far lane, i could have been stuck in a high speed lane resulting in injury to myself or others. The car is very low mileage and garage stored, so it is in very good condition and maintained regularly.was just in to the dealer less than 10 days prior (power steering esc recall) with no indication that there was a problem. This is a very serious safety issue.car currently at phillips chevy in frankfort, il.
I purchased the car in march 2013.it only had 18,000 miles on it.while slowing, such as exiting the interstate, as the car down shifts, it down shifts hard.especially going from 3rd gear to 2nd and then 1st.it seems to have a slight delay when trying to pick up speed.more so when you have slowed and then sped back up, like when someone is turning and you have to slow for them.there is an awful noise in the dash around the steering column.if you are on a gravel road, it sounds like the dash/steering column is going to fall onto your feet. Its a rattle type sound.
The contact owns a 2012 chevrolet malibu. The contact had the vehicle repaired under nhtsa campaign number: 14v252000 (electrical system, electronic stability control, exterior lighting, service brakes, hydraulic, vehicle speed control); however, the failure recurred. While driving approximately 45 mph, the traction control warning indicator illuminated. The vehicle was taken to a dealer where it was diagnosed that the bcm module needed to be replaced. The vehicle was not repaired. The manufacturer was notified of the failure. The approximate failure mileage was 22,000.updated 02/12/16*ljthe consumer has since sold the vehicle. Updated 02/22/16.
The engine light came on and a code read engine power reduced service esc. My car was shaking and would not gain speed. I was finally able to make it off the highway and stopped to see if i could figure out what was wrong. Could not see anything wrong. We got back in the car and everything seemed to be working okay now so we headed home. We got almost home when once again my car lost all speed and we were almost hit by another car.this has happened on several occassions.
On 12/26/13 myself and two other ladies were heading home early morning when all of a sudden my vehicle just shut down in the middle of the hwy. Without warning, luckily no traffic was coming because we had to push the vehicle off the hwy. After it sat for awhile it cranked back up and we managed to get it home. I drove it to work 12/27/13 but it did the same thing twice (once before 8 a.m. When i stopped at a gas station to get something to drink and again at 12:00 p.m. On my lunch break) during my lunch break i was at the gas station pumping gas, i turned off the engine to pay for my gas. When i returned my car wouldn't crank. I called the dealership, they connected me to the service department. The service man offered to come tow my vehicle, but after about 30 minutes it, of course, cranked. Nonetheless i gave them the address of my employment and told them to come pick it up so they could find out what was wrong with it. That same day the service man replaced the relay switch and said the problem was taken care of and i could pick up my car. I picked up my car on 12/30/13. On my way home on this same day (12/30/13) my vehicle shut down at the red light with traffic backed up behind me. I took my vehicle back to them and they kept it almost 2 weeks and could not find anything wrong with it but offered to replace the fuel tank, hoping this would solve the problem. I called them on 3/24/14 because my vehicle shut down again on 3/23/14, no one has returned my call. Can someone please tell me what is going on with this vehicle.
The car struggles to pick up speed.the rpms go up to between 4 and 5 and it doesnt shift when it should.it struggles accelerating to go up hills.the same rpm issue happens no matter if car was just started or had been running for long time.the check engine light wont shut off.mechanic hooked it up to diagnose it, result showed it was solenoid.replaced solenoids and light remained on.reset check engine light.light came back on.hooked it up to diagnose, still reported solenoid.
The contact owns a 2012 chevrolet malibu. The contact stated that the vehicle accelerated without the accelerator pedal being depressed. The contact was unable to stop the vehicle and crashed into a house. The contact sustained injuries to the head, neck, rib cage and the lower back. A police report was filed. The vehicle was destroyed and was not inspected to determine the cause of the failure.the vin was not available. The failure mileage and current mileages were 10,000.
Was driving on the interstateand car message center displayed engine speed reduced then it displayed within 5 minutes of the first message engine disabled . Car while not start.
I was driving to town and everything stop working. It scard the crap out of me. I took it to smith chevy in turlock ca they said they didnt know what was wrong with it and charaged me 489.00. Lucky it didnt kill me. Gm motors need to do a recall on it before someone gets hurt or lose there life.
A brand new vehicle with 64 miles. While driving on a rural road, the electronic stability control failure light came on and then the accelerator stopped working. After i turned the engine off, it would not come back on.this certainly could have been a safety issue had i lost control on a more traveled street.coincidentally, the only other complaint listed on nhtsa for this vehicle is for the exact same issue.
Vehicle has the check engine light come on and reduced power kicks in with no warning.vehicle has been driven at speed on highways when this happens and automatically slows to 40 mph.vehicle has been taken to the dealership and repairs made the first 2 times, vehicle has been taken back 3 more times for the same issue, no codes showing in the computer.issue also reported that if at a stop, vehicle has no response when you step on the gas.the dealership is currently trying to report this as a different issue so they can avoid dealing with the lemon law in the state.
Power esc, traction control, reduced power to engine, and tire lights all came on. Car would not go over 30 mph. Car was hesitating and cutting off and once placed in drive car took off by itself with rpms at 3 and same with reverse, i took foot off brake and car took off in reverse with rpms a bit over 2. Air conditioning will not work steadily and its been to a few shops and brakes will not work properly and they have been changed twice.
While lifting offfrom full acceleration, the throttle pedal had been fully depressed, the right side toe area of my right shoe ( a tennis shoe) became wedged between the throttle pedal and the sharply curved right side panel of the foot box, the result was this was stopping the car from decelerating as i wanted it to do. In order to release my foot i had to fully depress the accelerator pedal and then rotate my right for counter clockwise so that when i released the pedal the toe area of my shoe would not become trapped again.i looked at the foot box area and the side plastic panel has an very abrupt curve shape that acts as a trap if you happen to rotate your foot to the right under full throttle acceleration. This was a chevrolet malibu 2012 rental car from avis.
I was driving 45 the posted speed limit, and all of sudden the car chimed 4-5 times and the check engine light came on as well as the electronic stability control light and then i went from 45 to about 15 quick and it now says engine power reduced. There wasn't that much traffic so i kept driving to get home but a couple minutes later it shut off completely so i 3 to a safe place to pull over tried to start after a few attempts it started up and was fine except it jumps and then acts like it's going to shut off.
The contact owns a 2012 chevrolet malibu. The contact stated that while driving with the cruise control activated at 65 mph, the speed suddenly increased to 73 mph independently. The failure was experienced several times. The vehicle was taken to the dealer to be inspected. The dealer advised that there were no failures found within the cruise control system. The manufacturer was made aware of the failure. The vehicle was not repaired. The approximate failure mileage was 3,800 and the current mileage was 5,200.
I was driving to work and the service traction light control illuminates and then it also read engine power control. The roads were clearand there were no issues with the drive. I was the only person on the highway and no issues. I had to then drive 30-40 miles per hour on the road, even when i drove into town there were cars passing me. Uphill the car went as low as 23 miles per hour. When the car was idle at a stop sign or intersection the car would shake but it stayed on. As i pushed on the gas to speed up the vehicle would jerk.
Takata recall. My vehicle have had this system pop on a few times. As of september the light has been on abd and has not gone off. It also affect the esc system.
I brought my vehicle into a chevrolet center near me to have a 'manufacturers warranty fix' done to my vehicle on 04/17/2021, as the power steering had failed and i was able to get this fixed for free. When i turned my vehicle on and noticed the power steering notification on my dash, i tried to back my car out of where i was parked and move my wheel, but could not move the wheel. When the part was replaced, i was told that there were still sensors on my dash indicating that i needed the esc and stability traction control serviced for my car. According to the chevrolet dealership, this had 'nothing to do with the special policy fix' and not something they would be fixing for me. After checking the nhtsa.gov for any recalls on my 2012 chevy malibu, i found one from may 2014 that described exactly the problem i was having with my vehicle: loss of vehicle stability traction control, cruise control and random illumination of brake lights. I contacted chevy once again about this recall, to which they said there 'was no recall for the vehicle, and if there was it was already fixed'. Not only was this completely unprofessional and lacking concern of safety for my child and i, i do not know where to turn to for this to be remedied. Attached is the ticket for the initial fix i had done.
While driving passenger side low beam stopped working, then came back on after a few days. Now both passenger and driver low beams are not working. High beams are fine. I always used the automatic lighting to have them turn on/off for anytime i drive. Low beams required new headlamps and melted relay, replaced that as well. Service esc and traction control lights come on dash, then turn off, then come back on. It is intermittent and won't ever stay on long enough to have checked. Usually it happens when stopped at a stoplight and then when you start to accelerate again it goes off.
Do not remember when i brought my car in for campaign 14v252000 maybe approx. A year ago. The problems the car was having before i had the recall done have started again. Up until now haven't had any problems. My dealer wants to charge me to fix it.
The contact owns a 2012 chevrolet malibu. The contact stated that there was a burning odor coming from the rear of the vehicle. The contact also stated that the rear defrosted failed to function. The vehicle was taken to an independent mechanic who replaced the fuses and noticed sparks. The failure recurred. The vehicle was taken to a dealer who replaced the fuse or junction box. In addition, the contact stated that while driving during inclement weather conditions, the windshield wipers failed. The vehicle was taken to a dealer where the windshield wiper transmission was replaced. The vehicle was included in nhtsa campaign number: 15v269000 (seat belts) and was unable to determine when the part would become available for the repair. The manufacturer was notified of the failures. The approximate failure mileage was 48,000....updated 02/19/16 updated 10/25/2017
I was on my way to work. It was 57 degrees outside so i turned my rear defrost on. After about 5min of my defrost being on, my back window completely exploded. Im not sure if there was a short in the defroster or what but there was no visible damage to anything on the vehicle except the window that completely spiderwebbed.
Driver side low beam keeps shorting out even after replacing bulbs and harness.windshield wipers bushing broke in middle of rainstorm on 6/7/19 in suffolk va on interstate 664 south bound
I was driving down the road the other day while it was raining and my wipers stopped working had it looked at and my small arm on my linkage disconnected due to rust on the ball joint i looked contactedgm they knew nothing about it but i googled it and im not the only one who has had this issue definitelyshould be a recall just like 2013 terrain. Parts are very similar if not the same.
While driving in snow on 12/23/17, my wipers quit working. The snow was large flakes that turned to water when they hit the windshield, so it was like rain. I was on the ohio turnpike, so rate of speed was fast. I was able to pull over to the shoulder. I couldn't get the wipers to work, so i had to call a tow truck. It was unsafe to drive. After the snow stopped, i was able to complete my journey. I then had the wipers repaired. The wiper transmission failed. I believe this is a safety issue because the wipers can quit at anytime. Additionally i looked online and other malibu owners have had the same problem. (in fact the tow truck driver said he had towed a malibu owner 2 weeks earlier with the same problem.) i have never had my wipers fail with any other car i ever owned, and i asked others (non-malibu owners) if their wipers ever failed, and everyone i talked to said no. I contacted gm, but never received a response.
I have had issues with my windshield wipers for over a year. The linkage between the arm that moves the wipers and the motor will not stay connected. My first arm failure was due to a rubber bushing deteriorating. During a heavy rainstorm in nov. 2016, the wipers just stopped working completely and i had to be towed home. The second arm i purchased will not stay connected on the driver's side wiper, rendering my system useless. I am able to use my wipers about a dozen times before the arm has to be reconnected. After having it fixed 5+ times prior, they stopped working again this morning. I was in my driveway trying to simply wash my windshield before leaving for work.the system is poorly put together and will not stay connected. It seems to be held together by only tension with gravity working against it. This is extremely dangerous and i don't know how they can get away with it! living in new england with lots of extreme weather, this is just unacceptable.
The contact owns a 2012 chevrolet malibu. While driving approximately 60 mph during inclement weather, the windshield wipers failed. The vehicle was taken to an independent mechanic where it was diagnosed that the ball joints in the windshield wiper modules needed to be replaced. The vehicle was repaired. The manufacturer was made aware of the failure. The failure mileage was 100,000....updated 03/13/17
Timing chain needs repair only 80,000 miles on car bought it certified used warranty is up im very upset was driving on express way engine light came on had it checked at dealership
I have a 2012 chevy malibu. Thus is my everyday vehicle and when i have headlight problems it is very frustrating. We have had the bumper off this car multiple times which is a real pain. We have changed headlights, wiring harness and even undoing the battery. The passenger light comes on for a bit them will go off and not come back on. I have a loan on this car and can't even get rid of it cause i can't keep the lights on. Worse chevy car i have ever owned. I have been pulled over for it being out and how am i supposed to explain it. Reading the reviews of this car online i am not the only person that has headlight problems.
Back windshield shattered while sitting still.
Car was parked with rear defogger and heat running, loud explosion cracking noise and the rear windshield had exploded into spiderwebs.got out of the car to inspect the damage -- other people parked saw the incident and no one saw anything hit the windshield ( parked at school dropping off kids ).nothing was found that indicated the window had been struck in any way.the rear window defroster was warm to the touch in several areas of the spiderwebbed window.outside temperature was approximately 0 degrees.car had been running for about three hours.
The windshield wiper transmission / linkage seems to have a weak point in the plastic / nylon snaps. The linkage arm disconnects at the snap frequently during use of the wipers causing them to be completely unusable, which creates an extremely dangerous situation when driving in the rain or snow as you cannot see since the windshield is not able to be cleared.
Pulling out of a parking space, all of a sudden my steering wheel does a quick jerk, my traction light luminates and then service esc comes up on the display and then power steering shows on the display and at that point iost power steering assist and at this point i could not turn the wheel at all, i had no control over the car at this point.i put the car in park, turned it off for several minutes and then turned it back on and power steering was back.this is unexceptable...what if i had been on the free way going 70 miles per hour and lost power steering.this very issue was a recall on the recalling certain model year 2004-2006 and 2008-2009 chevrolet malibu(s) and obviously it is still an issue with the 2012 model.i have had no issues with steering prior to ths day it happened 10/30/16 and no warring power steering assist was going to fail.fix it once and for all gm. Do your customers have to be seriously injured or worse in order for you to get this right!!!!now we have to find the power steering unit and get it fixed because my car is literally a death trap.also, the interior lights (dome) and headlights start flickering after 10 mins to 60 mins into my drive like there is an electrical issue. Also, the rear defrost stopped working and i can't see out the rear window, i have to drive with the windows down to try and hurry the process along and that is not fun when it is freezing out side!
Driver side headlight malfunctioning multiple times in past year. Head light will go out, at first could tap on head light and it would come back on. Have changed pigtail and bulbs only to have it work for a short period of time.
On 11/18/2015 my wiper blades stopped working in heavy down pour of rain ,had to turn around and go to the closest repair garage to have them look at. They replace the wiper linkage. So 225.69 dollars later i was on my way. Than on 3/10/2016 upon driving home from work in rain i heard a couple of bang and the wipers stopped working again the same problem and wiper linkage was replace part was under warranty this time it only cost 72.00 dollars for the labor.
In 2016 the wiper motor went up and i had it replaced at a chevy dealership and again in 2019 the wiper motor went up again.i can load up the documents if needed.
The vehicle was being driven at the speed limit when the tire popped. The impact was as much as a front end collision; the windshield cracked along with the passenger side of the bumper and the wheel was bent. A mechanic said that because the seat belts locked the impact was great enough where the airbags should have gone off, but they did not.
The contact owns a 2012 chevrolet malibu. While driving, the headlights and windshield wipers failed to work. There were no warning indicators illuminated before or during the failure. The vehicle was taken to an independent mechanic who could not diagnosis the failure. The dealer (superior chevrolet, 4770 covington hwy, decatur, ga 30035) was contacted. The vehicle was not repaired. The manufacturer was not notified of the failure. The failure mileage was 141,000. The vin was not available.
While driving on a state highway, i had a number of functions stop working.the problem could come and go for a week before it happened on all ignition cycles.note, the problem could even come and go on 1 ignition cycle. The following stopped working: windshield wipers, heated seats, power windows/sunroof, power doors, power mirrors, blue tooth interface, dome lights and mirror / compass.dealer has replaced body control module and vpm.fixes seem to work for approximately 10-12 weeks before issues resurface.
I was driving on the ohio turnpike in a wet snow, and my wipers quit working. So i pulled to the shoulder to try to get them to start up again and they would not. So i had to call a tow company because it was unsafe to drive, and was towed to a truck stop. I waited till the snow stopped, and i checked the weather radar on my phone to make certain that it was safe to drive to my final destination. I took it to get repaired. The wiper motor/transmission quit working. Chevy has refused to reimburse me for the tow cost and the repair cost. This is a safety issue, because i couldn't see to drive in the snow. The same would've happened had it been raining. I reported this in january, but i believe it is worth reporting again. I have never had wipers quit on me. And i've been told it has happened to other malibu owners.
I have to replace my headlights every two weeks and have had to replace the plug outlet. Noticed that it is melting the plastic. This has been going on for a year now. Now it will not work it has happened on both driver and passenger side. Also have had my camshaft sensor replaced and keeps bringing up the check engine when i go get it read same code keeps going on.the camshaft issue is causing my car to stall in roadways making it dangerous for me and my daughter when in the car.
Passenger side low beam headlight keep going out i have replaced bulb and socket several times ..it work only for 2 weeks and problem keep coming ..this is fifth time i'm having to fix the issues
Parked in an intersection old hwy us 301 ocala floridawheels turned left which was dark and poorly lit by the city. No orange lights onto a major thin 2 lane intersection. The vehicle was braked during the left turn south position. The front hood in the middle of north bound lane front bumper and plate were in the highway dividing line. Up to the rear driverside passenger doorat the joint of the side street and highway outside line.a bicyclist struck the vehicle his light was thrown into the intersection. He is bleeding hes on the ground. Another female is helping him. The mirror of the vehicle driverside torn off and the front winshield shattered above driverside top. Thrown by impact from his bicycleto the malibu his backpack on the ground. Hes ambulatory transported sheriffs responded fhp came out
While driving at freeway speed (70 mph) in a rainstorm in traffic, the wiper internal drive assembly failed without warning causing loss of wiper function, resulting in loss of vision of other traffic requiring emergency stop.
The contact owns a 2012 chevrolet malibu. The contact stated that while driving, the windshield wiper was activated due to the rain weather condition and there was an abnormal noise. The contact noticed that the windshield wiper was fractured.the vehicle was taken to an independent mechanic where it was diagnosed that the windshield wiper linkage had detached.the vehicle was not repaired. The manufacturer was notified of the failure. The failure mileage was not available. The vin was not available.
Both headlamps have gone out within a nine month period. The driver side has been changed twice, the passenger side once. It seems every three months a headlight burns out on my car. As for the wipers, when they are turned on, they swipe halfway and stop until i turn them off and back on or to a higher swiping speed. This has happened as the vehicle was in park and drive. Also, the key fob battery has been replaced twice and works seldomly. The locks have recently starting locking on their own after the vehicle is shut off and the driver door is shut.
2012 chevy malibu, windshield wiper transmissioni was driving on the highway today, during a rainstorm, when the wipers failed to operate while driving 70 mph on mi 696.i was on a 4 lane highway and could not see at all do to the failed wiper transmission bushing.this not only put myself in danger but other drivers as well.i could not see at all and caused many other drivers to swerve out of their lanes at 70 mph.plastic bushings are used on the wiper transmission (linkage) which has been a commonly reported event.this is a design flaw which is causing the wipers to fail, making visibility during inclement weather impossible.this is a safety hazard.gm only offers a replacement wiper transmission with the same plastic bushings that keep failing.this is a design flaw that would have a minimal cost if they used metal bushings.this plastic bushing may eventually kill someone from failed wiper usage.
The contact owns a 2012 chevrolet malibu. While driving 15 mph, the heating motor malfunctioned, which caused smoke to filter into the cabin of the vehicle. It was diagnosed that the blower motor needed to be replaced. The vehicle was not repaired. The manufacturer was made aware of the issue. The failure mileage was approximately 44,000.
I had my rear window defogger on because it was a rainy, humid nightit was on for about 10 minutes and then my rear window shattered.there was no other damage to the car except for the window.
Crack in the weld at one of the spokes where it is connected to the wheel. So far 3 of the 4 wheels have failed.
Was driving in the rain, vehicle does not handle well in inclement weather. Has issue with braking, tires skid.when i hit the gas pedal after a stop, the tires skid. . recently has a alignment done, and the tires are in very good condition. Thought maybe that was the issue, i was wrong.vehicle had recent inspection "brakes are in very good condition. Vehicle has had issues since purchase.my family and i were belted in as always, while driving the dash console light came on "service air bag" the light stayed on constant for approx. 30 min then went out. I have called the dealer and will have vehicle checked at appointment in 2 weeks.
The vehicle was being driven at the speed limit when the tire popped. The impact was as much as a front end collision; the windshield cracked along with the passenger side of the bumper and the wheel was bent. A mechanic said that because the seat belts locked the impact was great enough where the airbags should have gone off, but they did not.
2012 chevrolet malibu. Consumer writes in regards to multiple safety defects with vehicle. *ldthe consumer stated the vehicle has several safety defects including the electric stability control, brakes, sensor lights, steering, suspension, wheels, engine lights, power train. Updated 10/23/2017
Fixed several times and still the service tire monitor is on as if it was the tpms.
I purchased new in 2012. It has 25,000 miles and never been abused or in an accident. All four tires firestone fr 710 p215 55r 17 have extensive cracking on sidewall where the tread begins on circumference and the treaded part appears to be separating from the sidewall. Dealer says that is normal and will not offer any price reduction on new tires. Common sense tells me otherwise.
My car has been making a horrible sound for a couple months now and the last week it's gotten really loud when i go over 20 it sounds the worst of slow down i can't go over 40 without it sounding like it's taking off and my front end shakes like my tires gonna come off i replaced the breaks and it's still making the sound it's to the point i can't drive my car because i don't want it to die on me my battery has been dying a lot and my service esc light comes on and goes off please can someone tell me why my car is doing this or an idea it sounds like an airplane that's the best way i can describe it and my right rear tire is always saying my tire is low i rotated my tires and it's still not reading it right there brand new tires to boot please please help me
A left front flat tire in december 2016 (four tires bought new in may 2016) was discovered to not be a problem with the tire, but the factory-installed, original equipment rim with a seam crack. Now today in january 2017, a flat tire on the right front was diagnosed as the result of a second bad rim, again one of the four factory-installed original equipment rims (two more to go?). It was necessary to replace both the rim and the valve stem each time. Research is showing another complaint has been filed for this same problem with the other report having had to replace three rims so far. This definitely appears to be a supplier/manufacturing defect. The problem was shown to me after the rim with the tire on it had been submerged in water, and bubbles formed at the defective area. Unfortunately i did not take a picture, not knowing about this website until i got home after this second repair/replacement and started my research. My only documentation are my two repair bills, which i can send if needed.
The contact owns a 2012 chevrolet malibu. While driving 60 mph, the vehicle experienced a loss of power steering. The vehicle was difficult to maneuver and a loud noise was heard coming from the front driver side wheel. The traction warning indicator illuminated. After several minutes, the vehicle was able to operate normally, but was vibrating. The vehicle was not diagnosed or repaired. The manufacturer was not made aware of the failure. The failure mileage was approximately 100,000.
While driving out of parking garage going minimal speed, my right rear passenger wheel dislocated from my vehicle.after getting it to a chevrolet dealership and further inspection, looks like the vehicle was originally assembled with only 2 of the needed 4 bolts attaching the wheel to the hub of the car.this caused strain to the 2 bolts and you can visibly see stress cracks on the hub where there were placed.
I was sold a car priced at $4,995 but when the initial contract was signed the car representative failed to keep the price the same and without consent overcharged me for the car $10,000 i called back a week later to notify them the car had went out, was in bad condition, wasn't driving, and put me and my family in harms way. Car shutoff twice in motion once while actually driving on the freeway. I asked to have it repaired due to the fact that i was forced into purchasing their warranty that he stated came with the car but put in the contract later that i would pay $1000+ dollars for it when it's an expired warranty from 2017 when the dealer first got the car so it's only a extended warranty and doesn't help with anything. He came once to repair the car by putting some fluid inside to make it run & instead told me he changed the battery which turned out to be false the car kept cutting off and going out i kept seeking help it was david and abn motorswho refused to fix any mechanical issue i was having with the vehicle and in return the car put me and my family in harms way it is a danger to have or drive with my kids cops said so also it cut off on the highway while driving and leaked an extremely large amount of oil while me and my kids were inside the vehicle i was forced to merge over completely to get out the way of traffic as the car just stopped motion. Something under the hood popped and the vehicle was smoky state officials order me and my family out the vehicle in toledo a hour drive away from my home. They stated it was a safety hazard and that i could not enter my vehicle and took it away. I had even sent over a message to the dealer representative i purchased the car from a month earlier stating i was having problems he refused to respond or help he stated that i already signed the contract and i should deal with it myself.
I have had two rim crack. This leads to air pressure loss. The tire store that i go. Les schwab said they have seen i already bought one new rim. Now i need another one. I asked the dealer and they said theyhave had a problem with these wheels. I don't believe them. I checked on the internet and several people have has the same problem.
Car was running on freeway and lights started flashing and then car so stalled and car doesnt start anymore
The plastic-covered lug nuts on my 2012 chevrolet malibu do not stay tight against the wheels.the oem lug nuts vibrate loose and need to be checked periodically (i.e., monthly).loose lug nuts are a significant safety hazard.i was unable to obtain replacement all-metal lug nuts for this vehicle from a chevrolet dealership.i suggest that chevrolet replace the plastic-covered lug nuts with all-metal lug nuts at no cost to the customers.
Read more
